Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENSA, Human (His)

ENSA protein is a key phosphatase inhibitor that precisely controls PP2A activity during mitosis by inhibiting PP2A. Phosphorylation of Ser-67 in mitosis promotes specific interaction with PPP2R2D, leading to inactivation of PP2A. ENSA Protein, Human (His) is the recombinant human-derived ENSA protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ENSA Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ensa-protein-human-his.html

Purity

95.0

Smiles

MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE

Molecular Formula

2029 (Gene_ID) O43768-1 (M1-E121) (Accession)

Molecular Weight

Approximately 17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ascl3 Antibody
OAEB01062-100UG 100 µg

Ascl3 Antibody

Sign In for Pricing
View Details
Fbx32/FBOX32 Polyclonal Antibody
E-AB-93393-01 60 µL

Fbx32/FBOX32 Polyclonal Antibody

Sign In for Pricing
View Details
Fbx32/FBOX32 Polyclonal Antibody
E-AB-93393-02 120 µL

Fbx32/FBOX32 Polyclonal Antibody

Sign In for Pricing
View Details
Fbx32/FBOX32 Polyclonal Antibody
E-AB-93393-03 200 µL

Fbx32/FBOX32 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Shigella Sonnei cysN Protein (aa 1-475)
VAng-Lsx09618-1mgEcoli 1 mg (E. coli)

Recombinant Shigella Sonnei cysN Protein (aa 1-475)

Sign In for Pricing
View Details
eNOS Rabbit pAb
A5606 100 µL

eNOS Rabbit pAb

Sign In for Pricing
View Details