Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENSA, Human (His)

ENSA protein is a key phosphatase inhibitor that precisely controls PP2A activity during mitosis by inhibiting PP2A. Phosphorylation of Ser-67 in mitosis promotes specific interaction with PPP2R2D, leading to inactivation of PP2A. ENSA Protein, Human (His) is the recombinant human-derived ENSA protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ENSA Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ensa-protein-human-his.html

Purity

95.0

Smiles

MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE

Molecular Formula

2029 (Gene_ID) O43768-1 (M1-E121) (Accession)

Molecular Weight

Approximately 17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGAP22 CRISPRa sgRNA lentivector (set of three targets)(Rat)
12288126 3x 1.0µg DNA

ARHGAP22 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Gm14431 AAV Vector (Mouse) (CMV)
21853104 1 µg

Gm14431 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
FGFR3 Antibody, FITC conjugated
A21955-50UG 50 µg

FGFR3 Antibody, FITC conjugated

Sign In for Pricing
View Details
IFI16 Antibody
KC-3772-01 50 μL

IFI16 Antibody

Sign In for Pricing
View Details
IFI16 Antibody
KC-3772-02 100 µL

IFI16 Antibody

Sign In for Pricing
View Details
IFI16 Antibody
KC-3772-03 1 mL

IFI16 Antibody

Sign In for Pricing
View Details