Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENSA, Human (His)

ENSA protein is a key phosphatase inhibitor that precisely controls PP2A activity during mitosis by inhibiting PP2A. Phosphorylation of Ser-67 in mitosis promotes specific interaction with PPP2R2D, leading to inactivation of PP2A. ENSA Protein, Human (His) is the recombinant human-derived ENSA protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ENSA Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ensa-protein-human-his.html

Purity

95.0

Smiles

MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE

Molecular Formula

2029 (Gene_ID) O43768-1 (M1-E121) (Accession)

Molecular Weight

Approximately 17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 3 Receptor alpha (IL3RA) Antibody (PE)
abx139577 100 Tests

Interleukin 3 Receptor alpha (IL3RA) Antibody (PE)

Sign In for Pricing
View Details
SERTAD2 Antibody - N-terminal region : HRP (ARP51654_P050-HRP)
ARP51654_P050-HRP 100 µL

SERTAD2 Antibody - N-terminal region : HRP (ARP51654_P050-HRP)

Sign In for Pricing
View Details
Recombinant ZHX2 Antibody
RC-4266-01 50 μL

Recombinant ZHX2 Antibody

Sign In for Pricing
View Details
Recombinant ZHX2 Antibody
RC-4266-02 100 µL

Recombinant ZHX2 Antibody

Sign In for Pricing
View Details
Recombinant ZHX2 Antibody
RC-4266-03 1 mL

Recombinant ZHX2 Antibody

Sign In for Pricing
View Details
NUMB Antibody
36663 100 µL

NUMB Antibody

Sign In for Pricing
View Details