Animal-Free MIF, Mouse (His)
The MIF protein is a pro-inflammatory cytokine that plays a crucial role in the innate immune response against bacterial pathogens.Its presence at sites of inflammation suggests its role as a mediator in the regulation of macrophage function during host defense.Animal-Free MIF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMIF protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free MIF Protein, Mouse (His), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-mif-protein-mouse-his.html
Purity
95.00
Smiles
MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA
Molecular Formula
17319 (Gene_ID) P34884 (M1-A115) (Accession)
Molecular Weight
Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL
CD52 (Epididymis-Specific Protein 5) (CD52/2276R), CF640R conjugate, 0.1mg/mL
