Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free SCF, Human (His)

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. Animal-Free SCF Protein, Human (His) is the recombinant human-derived animal-FreeSCF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free SCF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-scf-protein-human-his.html

Purity

95.0

Smiles

MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Molecular Formula

4254 (Gene_ID) P21583-1 (E26-A189) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXC2 sgRNA CRISPR Lentivector (Human) (Target 3)
K0795204 1.0 µg DNA

FOXC2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Hexen-5-ol
TRC-H295025-100MG 100 mg

Hexen-5-ol

Sign In for Pricing
View Details
LIM domain-binding protein 2 (LDB2) Chicken ELISA Kit
E6938 96 Tests

LIM domain-binding protein 2 (LDB2) Chicken ELISA Kit

Sign In for Pricing
View Details
SCOC Protein Vector (Mouse) (pPM-C-His)
PV227129 500 ng

SCOC Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
ECE-1 CRISPR Activation Plasmid (h2)
sc-402379-ACT-2 20 µg

ECE-1 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
CHPF 3'UTR GFP Stable Cell Line
TU054375 1.0 mL

CHPF 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details