Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free SCF, Human (His)

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. Animal-Free SCF Protein, Human (His) is the recombinant human-derived animal-FreeSCF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free SCF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-scf-protein-human-his.html

Purity

95.0

Smiles

MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Molecular Formula

4254 (Gene_ID) P21583-1 (E26-A189) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-mmu-mir-3099 Virus
mm0331 1.0 mL

AdmiRa-mmu-mir-3099 Virus

Sign In for Pricing
View Details
GLULP2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV762244 1.0 µg DNA

GLULP2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
C9orf72 Rabbit Polyclonal Antibody
TA355014 100 µg

C9orf72 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Mob1a shRNA (UAS) - Lentiviral mouse Mob1a shRNA (UAS, iRFP) (25)
GTR15305021 1 Vial

Lentiviral mouse Mob1a shRNA (UAS) - Lentiviral mouse Mob1a shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Human Zinc finger protein 454, ZNF454 ELISA Kit
MBS9317723-01 48 Well

Human Zinc finger protein 454, ZNF454 ELISA Kit

Sign In for Pricing
View Details
Human Zinc finger protein 454, ZNF454 ELISA Kit
MBS9317723-02 96 Well

Human Zinc finger protein 454, ZNF454 ELISA Kit

Sign In for Pricing
View Details