Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free SCF, Human (His)

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. Animal-Free SCF Protein, Human (His) is the recombinant human-derived animal-FreeSCF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free SCF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-scf-protein-human-his.html

Purity

95.0

Smiles

MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Molecular Formula

4254 (Gene_ID) P21583-1 (E26-A189) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1449 (NM_146303) Mouse Tagged ORF Clone Lentiviral Particle
MR213143L4V 200 µL

Olfr1449 (NM_146303) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans vha-18 Polyclonal Antibody
MBS7191831 Inquire

Rabbit anti-Caenorhabditis elegans vha-18 Polyclonal Antibody

Sign In for Pricing
View Details
ZFP598(Phospho Tyr306) Polyclonal Antibody
JOT-AP15630-01 50ul

ZFP598(Phospho Tyr306) Polyclonal Antibody

Sign In for Pricing
View Details
ZFP598(Phospho Tyr306) Polyclonal Antibody
JOT-AP15630-02 100ul

ZFP598(Phospho Tyr306) Polyclonal Antibody

Sign In for Pricing
View Details
TMEM111 Protein Vector (Mouse) (pPM-C-HA)
46869024 500 ng

TMEM111 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Streptopain (speB) Antibody
abx319848-01 20 µg

Streptopain (speB) Antibody

Sign In for Pricing
View Details