Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free SCF, Human (His)

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. Animal-Free SCF Protein, Human (His) is the recombinant human-derived animal-FreeSCF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free SCF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-scf-protein-human-his.html

Purity

95.0

Smiles

MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Molecular Formula

4254 (Gene_ID) P21583-1 (E26-A189) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL23A antibody - N-terminal region
MBS3215417-01 0.1 mL

RPL23A antibody - N-terminal region

Sign In for Pricing
View Details
RPL23A antibody - N-terminal region
MBS3215417-02 5x 0.1 mL

RPL23A antibody - N-terminal region

Sign In for Pricing
View Details
Magic™ Membrane Protein Human PLA2R1 (Phospholipase A2 receptor 1) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, PaRoom Temperatureial (395-530aa)
MPX4497K Each

Magic™ Membrane Protein Human PLA2R1 (Phospholipase A2 receptor 1) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, PaRoom Temperatureial (395-530aa)

Sign In for Pricing
View Details
BMPR1B, NT (D17) (Bone Morphogenetic Protein Receptor Type-1B, BMP Type-1B Receptor, BMPR-1B, CDw293) (MaxLight 405) discontinued
B2553-63C-ML405 100 µL

BMPR1B, NT (D17) (Bone Morphogenetic Protein Receptor Type-1B, BMP Type-1B Receptor, BMPR-1B, CDw293) (MaxLight 405) discontinued

Sign In for Pricing
View Details
mmu-miR-6903-5p Primers
MPM01619 150 µL / 10 µM

mmu-miR-6903-5p Primers

Sign In for Pricing
View Details
TAS2R41, NT (TAS2R41, Taste receptor type 2 member 41, Taste receptor type 2 member 59) (Azide free) (HRP) discontinued
042615-HRP 200 µL

TAS2R41, NT (TAS2R41, Taste receptor type 2 member 41, Taste receptor type 2 member 59) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details