Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free SCF, Human (His)

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. Animal-Free SCF Protein, Human (His) is the recombinant human-derived animal-FreeSCF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free SCF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-scf-protein-human-his.html

Purity

95.0

Smiles

MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Molecular Formula

4254 (Gene_ID) P21583-1 (E26-A189) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Hydroxyacid Oxidase-1/HAO-1 Antibody (OTI5C3) [DyLight 550]
NBP2-71954R 0.1 mL

Mouse Monoclonal Hydroxyacid Oxidase-1/HAO-1 Antibody (OTI5C3) [DyLight 550]

Sign In for Pricing
View Details
Rabbit Monoclonal CD79A Antibody (IGA/1790R) [DyLight 550]
NBP3-11617R 0.1 mL

Rabbit Monoclonal CD79A Antibody (IGA/1790R) [DyLight 550]

Sign In for Pricing
View Details
CD151 (CD151 Antigen, CD151 Molecule, GP27, Membrane Glycoprotein SFA1, MER2, Platelet Endothelial Tetraspan Antigen 3, PETA 3, PETA-3, RAPH, SFA 1, SFA1, SFA-1, Tetraspanin-24, TSPAN-24) discontinued. See C2548-82E
C2548-82D 100 µL

CD151 (CD151 Antigen, CD151 Molecule, GP27, Membrane Glycoprotein SFA1, MER2, Platelet Endothelial Tetraspan Antigen 3, PETA 3, PETA-3, RAPH, SFA 1, SFA1, SFA-1, Tetraspanin-24, TSPAN-24) discontinued. See C2548-82E

Sign In for Pricing
View Details
Nrg3 (NM_001190188) Mouse Tagged Lenti ORF Clone
MR221720L4 10 µg

Nrg3 (NM_001190188) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Marfeys Reagent extrapure AR, 98%
43804-01 50 mg

Marfeys Reagent extrapure AR, 98%

Sign In for Pricing
View Details
Marfeys Reagent extrapure AR, 98%
43804-02 200 mg

Marfeys Reagent extrapure AR, 98%

Sign In for Pricing
View Details