Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free SCF, Human (His)

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. Animal-Free SCF Protein, Human (His) is the recombinant human-derived animal-FreeSCF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free SCF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-scf-protein-human-his.html

Purity

95.0

Smiles

MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Molecular Formula

4254 (Gene_ID) P21583-1 (E26-A189) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Cytokeratin 10 Antibody (KRT10/844) [PerCP]
NBP2-47825PCP 0.1 mL

Mouse Monoclonal Cytokeratin 10 Antibody (KRT10/844) [PerCP]

Sign In for Pricing
View Details
Anti-14?3?3 theta/YWHAQ Antibody (5O606)
MF-0066098-01 50 µL

Anti-14?3?3 theta/YWHAQ Antibody (5O606)

Sign In for Pricing
View Details
Anti-14?3?3 theta/YWHAQ Antibody (5O606)
MF-0066098-02 100 µL

Anti-14?3?3 theta/YWHAQ Antibody (5O606)

Sign In for Pricing
View Details
Rabbit Monoclonal CTHRC1 Antibody (062) [PerCP]
NBP2-89946PCP 0.1 mL

Rabbit Monoclonal CTHRC1 Antibody (062) [PerCP]

Sign In for Pricing
View Details
MAP4K2 Antibody, HRP conjugated
A28103-50UG 50 µg

MAP4K2 Antibody, HRP conjugated

Sign In for Pricing
View Details
TCEA3 Rabbit Polyclonal Antibody
MBS9517344-01 0.05 mL

TCEA3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details