Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free SCF, Human (His)

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. Animal-Free SCF Protein, Human (His) is the recombinant human-derived animal-FreeSCF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free SCF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-scf-protein-human-his.html

Purity

95.0

Smiles

MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Molecular Formula

4254 (Gene_ID) P21583-1 (E26-A189) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ebola virus Delta Peptide
0509-001 100 µg

Ebola virus Delta Peptide

Sign In for Pricing
View Details
Pknox1 Mouse shRNA Plasmid (Locus ID 18771)
TL501661 1 Kit

Pknox1 Mouse shRNA Plasmid (Locus ID 18771)

Sign In for Pricing
View Details
Recombinant Campylobacter Curvus cysS Protein (aa 1-460)
VAng-Lsx5942-500gEcoli 500 µg (E. coli)

Recombinant Campylobacter Curvus cysS Protein (aa 1-460)

Sign In for Pricing
View Details
CCDC38 (NM_182496) Human Tagged ORF Clone Lentiviral Particle
RC210674L3V 200 µL

CCDC38 (NM_182496) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
KPTN, ID (KPTN, Kaptin, Actin-associated protein 2E4) (MaxLight 750)
MBS6314445-01 0.1 mL

KPTN, ID (KPTN, Kaptin, Actin-associated protein 2E4) (MaxLight 750)

Sign In for Pricing
View Details
KPTN, ID (KPTN, Kaptin, Actin-associated protein 2E4) (MaxLight 750)
MBS6314445-02 5x 0.1 mL

KPTN, ID (KPTN, Kaptin, Actin-associated protein 2E4) (MaxLight 750)

Sign In for Pricing
View Details