Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free SCF, Human (His)

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. Animal-Free SCF Protein, Human (His) is the recombinant human-derived animal-FreeSCF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free SCF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-scf-protein-human-his.html

Purity

95.0

Smiles

MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Molecular Formula

4254 (Gene_ID) P21583-1 (E26-A189) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Hepatitis G Virus - 100 μg
18607-100μg 100 µg

Anti-Hepatitis G Virus - 100 μg

Sign In for Pricing
View Details
ZNF451 Human shRNA Plasmid Kit (Locus ID 26036)
TL308168 1 Kit

ZNF451 Human shRNA Plasmid Kit (Locus ID 26036)

Sign In for Pricing
View Details
BPIFB1 Antibody / LPLUNC1
V9138-100UG 100 µg

BPIFB1 Antibody / LPLUNC1

Sign In for Pricing
View Details
Human ZDHHC1 siRNA
abx940336-01 15 nmol

Human ZDHHC1 siRNA

Sign In for Pricing
View Details
Human ZDHHC1 siRNA
abx940336-02 30 nmol

Human ZDHHC1 siRNA

Sign In for Pricing
View Details
Mouse Monoclonal Blood Group Lewis b Antibody (2-25LE) [DyLight 550]
NB500-526R 0.1 mL

Mouse Monoclonal Blood Group Lewis b Antibody (2-25LE) [DyLight 550]

Sign In for Pricing
View Details