Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free SCF, Human (His)

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. Animal-Free SCF Protein, Human (His) is the recombinant human-derived animal-FreeSCF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free SCF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-scf-protein-human-his.html

Purity

95.0

Smiles

MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Molecular Formula

4254 (Gene_ID) P21583-1 (E26-A189) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse MEIS3 shRNA Plasmid
abx971568-01 150 µg

Mouse MEIS3 shRNA Plasmid

Sign In for Pricing
View Details
Mouse MEIS3 shRNA Plasmid
abx971568-02 300 µg

Mouse MEIS3 shRNA Plasmid

Sign In for Pricing
View Details
Rhox2-set siRNA/shRNA/RNAi Lentivector (Rat)
39537096 4x 500 ng

Rhox2-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
NOS1 (NM_000620) Human Tagged ORF Clone Lentiviral Particle
RC222384L3V 200 µL

NOS1 (NM_000620) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PAPPA, Recombinant, Human, Western Blot Control (Pappalysin-1, Insulin-like Growth Factor-dependent IGF-binding Protein 4 Protease, IGF-dependent IGFBP-4 Protease, IGFBP-4ase, Pregnancy-associated Plasma Protein A, PAPP-A) discontinued
P6000-83A 10 µg

PAPPA, Recombinant, Human, Western Blot Control (Pappalysin-1, Insulin-like Growth Factor-dependent IGF-binding Protein 4 Protease, IGF-dependent IGFBP-4 Protease, IGFBP-4ase, Pregnancy-associated Plasma Protein A, PAPP-A) discontinued

Sign In for Pricing
View Details
CNPY1 cDNA Clone
MBS1273492-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

CNPY1 cDNA Clone

Sign In for Pricing
View Details