Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free SCF, Human (His)

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. Animal-Free SCF Protein, Human (His) is the recombinant human-derived animal-FreeSCF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free SCF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-scf-protein-human-his.html

Purity

95.0

Smiles

MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Molecular Formula

4254 (Gene_ID) P21583-1 (E26-A189) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CDT1 (Recombinant Rabbit, Monoclonal, IgG)
A110557 100 µL

Anti-CDT1 (Recombinant Rabbit, Monoclonal, IgG)

Sign In for Pricing
View Details
Recombinant Human GNGT1/GNG1 Protein (His Tag)
PKSH030582 100 µg

Recombinant Human GNGT1/GNG1 Protein (His Tag)

Sign In for Pricing
View Details
ITGB2 Protein Vector (Human) (pPB-C-His)
PV021861 500 ng

ITGB2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
PCO1 Antibody
PHY7548S 150 μg

PCO1 Antibody

Sign In for Pricing
View Details
ERBB3 (Receptor Tyrosine-protein Kinase erbB-3, Proto-oncogene-like Protein c-ErbB-3, Tyrosine Kinase-type Cell Surface Receptor HER3, HER3) (MaxLight 650)
126421-ML650 100 µL

ERBB3 (Receptor Tyrosine-protein Kinase erbB-3, Proto-oncogene-like Protein c-ErbB-3, Tyrosine Kinase-type Cell Surface Receptor HER3, HER3) (MaxLight 650)

Sign In for Pricing
View Details
Zfp763 Mouse shRNA Plasmid (Locus ID 73451)
TR504841 1 Kit

Zfp763 Mouse shRNA Plasmid (Locus ID 73451)

Sign In for Pricing
View Details