Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free SCF, Human (His)

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. Animal-Free SCF Protein, Human (His) is the recombinant human-derived animal-FreeSCF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free SCF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-scf-protein-human-his.html

Purity

95.0

Smiles

MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Molecular Formula

4254 (Gene_ID) P21583-1 (E26-A189) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal S100P Antibody (OTI1A4) [DyLight 755]
NBP2-73972IR 0.1 mL

Mouse Monoclonal S100P Antibody (OTI1A4) [DyLight 755]

Sign In for Pricing
View Details
GSK3 beta Antibody: HRP
MBS8001088-01 0.1 mg

GSK3 beta Antibody: HRP

Sign In for Pricing
View Details
GSK3 beta Antibody: HRP
MBS8001088-02 5x 0.1 mg

GSK3 beta Antibody: HRP

Sign In for Pricing
View Details
G2/mitotic-specific cyclin-B2 (CCNB2) Mouse ELISA Kit
D5639 96 Tests

G2/mitotic-specific cyclin-B2 (CCNB2) Mouse ELISA Kit

Sign In for Pricing
View Details
Lentiviral human PIP4P2 shRNA (UAS) - Lentiviral human PIP4P2 shRNA (UAS, iRFP) (100)
GTR15102387 1 Vial

Lentiviral human PIP4P2 shRNA (UAS) - Lentiviral human PIP4P2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Cytokeratin 12 Overexpression Lysate (Native) - (Dry Ice)
NBP2-09047 0.1 mg

Cytokeratin 12 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details