Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free SCF, Human (His)

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. Animal-Free SCF Protein, Human (His) is the recombinant human-derived animal-FreeSCF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free SCF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-scf-protein-human-his.html

Purity

95.0

Smiles

MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Molecular Formula

4254 (Gene_ID) P21583-1 (E26-A189) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

A430078G23Rik 3'UTR GFP Stable Cell Line
TU151057 1.0 mL

A430078G23Rik 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
SPTLC1P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV749479 1.0 µg DNA

SPTLC1P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
TMPO Polyclonal Antibody
bs-55216R 100 µL

TMPO Polyclonal Antibody

Sign In for Pricing
View Details
FERMT3 Protein Vector (Human) (pPM-C-His)
PV016080 500 ng

FERMT3 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Monoclonal HLA-DRB (MHC II) Antibody - Without BSA and Azide, Clone: SPM423
AMM00852G 0.1mg

Monoclonal HLA-DRB (MHC II) Antibody - Without BSA and Azide, Clone: SPM423

Sign In for Pricing
View Details
IL17F (Interleukin-17F, IL-17F, Cytokine ML-1, Interleukin-24, IL-24, IL24) (AP) discontinued
128412-AP 100 µL

IL17F (Interleukin-17F, IL-17F, Cytokine ML-1, Interleukin-24, IL-24, IL24) (AP) discontinued

Sign In for Pricing
View Details