Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free SCF, Human (His)

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. Animal-Free SCF Protein, Human (His) is the recombinant human-derived animal-FreeSCF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free SCF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-scf-protein-human-his.html

Purity

95.0

Smiles

MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Molecular Formula

4254 (Gene_ID) P21583-1 (E26-A189) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIMD1 Protein Vector (Human) (pPM-C-His)
PV054324 500 ng

LIMD1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Htra1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4868704 1.0 µg DNA

Htra1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
HMGB1 (High-Mobility Group Box 1, DKFZp686A04236, HMG1, HMG3, SBP-1) (MaxLight 490)
247139-ML490 100 µL

HMGB1 (High-Mobility Group Box 1, DKFZp686A04236, HMG1, HMG3, SBP-1) (MaxLight 490)

Sign In for Pricing
View Details
ZNHIT1 (NM_006349) Human Recombinant Protein
TP721004XL 1 mg

ZNHIT1 (NM_006349) Human Recombinant Protein

Sign In for Pricing
View Details
KCNV2, CT (KCNV2, Potassium voltage-gated channel subfamily V member 2, Voltage-gated potassium channel subunit Kv8.2) (MaxLight 650) discontinued
037352-ML650 100 µL

KCNV2, CT (KCNV2, Potassium voltage-gated channel subfamily V member 2, Voltage-gated potassium channel subunit Kv8.2) (MaxLight 650) discontinued

Sign In for Pricing
View Details
TMEM65 (HRP) discontinued
579443-01 50 µg

TMEM65 (HRP) discontinued

Sign In for Pricing
View Details