Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free SCF, Human (His)

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. Animal-Free SCF Protein, Human (His) is the recombinant human-derived animal-FreeSCF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free SCF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-scf-protein-human-his.html

Purity

95.0

Smiles

MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Molecular Formula

4254 (Gene_ID) P21583-1 (E26-A189) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Hermansky-Pudlak syndrome 5 protein (HPS5) ELISA Kit
MBS7221261-01 48 Well

Monkey Hermansky-Pudlak syndrome 5 protein (HPS5) ELISA Kit

Sign In for Pricing
View Details
Monkey Hermansky-Pudlak syndrome 5 protein (HPS5) ELISA Kit
MBS7221261-02 96 Well

Monkey Hermansky-Pudlak syndrome 5 protein (HPS5) ELISA Kit

Sign In for Pricing
View Details
Monkey Hermansky-Pudlak syndrome 5 protein (HPS5) ELISA Kit
MBS7221261-03 5x 96 Well

Monkey Hermansky-Pudlak syndrome 5 protein (HPS5) ELISA Kit

Sign In for Pricing
View Details
Monkey Hermansky-Pudlak syndrome 5 protein (HPS5) ELISA Kit
MBS7221261-04 10x 96 Well

Monkey Hermansky-Pudlak syndrome 5 protein (HPS5) ELISA Kit

Sign In for Pricing
View Details
Lcmt1 (NM_199405) Rat Tagged Lenti ORF Clone
RR209059L3 10 µg

Lcmt1 (NM_199405) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
BUBBLE PADDLE RESERVOIR, Magnetic Clutch Powered, 96 Channel, PTFE Reservoir, Sculpted Bottom, Overflow Weir and Inlet, with 4 Bubble Paddles, Parylene Coated, 13 Bubbles/Paddle, Mates to VP 763B, Mixes 200mL, SLAS Footprint
VP 756C-96BPTFE 1 Each

BUBBLE PADDLE RESERVOIR, Magnetic Clutch Powered, 96 Channel, PTFE Reservoir, Sculpted Bottom, Overflow Weir and Inlet, with 4 Bubble Paddles, Parylene Coated, 13 Bubbles/Paddle, Mates to VP 763B, Mixes 200mL, SLAS Footprint

Sign In for Pricing
View Details