Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free SCF, Human (His)

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. Animal-Free SCF Protein, Human (His) is the recombinant human-derived animal-FreeSCF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free SCF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-scf-protein-human-his.html

Purity

95.0

Smiles

MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Molecular Formula

4254 (Gene_ID) P21583-1 (E26-A189) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Akirin2, Control Peptide (C6orf166, chromosome 6 open reading frame 166, dJ486L4.2, FBI1, FLJ10342, Protein C6orf166, Uncharacterized protein C6orf166)
149092 50 µg

Akirin2, Control Peptide (C6orf166, chromosome 6 open reading frame 166, dJ486L4.2, FBI1, FLJ10342, Protein C6orf166, Uncharacterized protein C6orf166)

Sign In for Pricing
View Details
SH3BGRL3, ID (SH3BGRL3, SH3 domain-binding glutamic acid-rich-like protein 3, SH3 domain-binding protein 1) (PE) discontinued
041688-PE 200 µL

SH3BGRL3, ID (SH3BGRL3, SH3 domain-binding glutamic acid-rich-like protein 3, SH3 domain-binding protein 1) (PE) discontinued

Sign In for Pricing
View Details
Col16a1 Mouse shRNA Plasmid (Locus ID 107581)
TR505790 1 Kit

Col16a1 Mouse shRNA Plasmid (Locus ID 107581)

Sign In for Pricing
View Details
LENG9 Protein Vector (Mouse) (pPB-N-His)
PV196323 500 ng

LENG9 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Guinea pig Chorionic Gonadotrophin β (β CG) ELISA Kit
NSL1154Gp 96 Tests

Guinea pig Chorionic Gonadotrophin β (β CG) ELISA Kit

Sign In for Pricing
View Details
2310007B03Rik (NM_001159940) Mouse Tagged ORF Clone Lentiviral Particle
MR207216L4V 200 µL

2310007B03Rik (NM_001159940) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details