What is the catalog number for LIF, Human?

The catalog number for LIF, Human is HY-P7049.

What sizes are available for LIF, Human?

LIF, Human is available in the following size(s): 2 µg, 10 µg, 50 µg, 100 µg.

How many pack sizes does LIF, Human come in?

LIF, Human is available in 4 different pack sizes.

Is LIF, Human in stock?

LIF, Human is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures LIF, Human?

LIF, Human is manufactured by QuantiMol.

What is the estimated delivery time for LIF, Human?

Estimated delivery time for LIF, Human is approximately 15 business day(s), depending on your location.

LIF, Human

LIF Protein, Human is a lymphoid factor involved in various neural and inflammatory processes such as the acute-phase reaction, tissue damage, and infection.

Product Specifications

Product Name Alternative

LIF Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/lif-protein-human.html

Purity

98.0

Smiles

SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Molecular Formula

3976 (Gene_ID) P15018-1 (S23-F202) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Metcalf D, et al. Effects of injected leukemia inhibitory factor on hematopoietic and other tissues in mice. Blood. 1990 Jul 1;76 (1) :50-6.|[2]Banner LR, et al. Leukemia inhibitory factor is an anti-inflammatory and analgesic cytokine. J Neurosci. 1998 Jul 15;18 (14) :5456-62.|[3]Gearing DP, et al. Leukemia inhibitory factor receptor is structurally related to the IL-6 signal transducer, gp130. EMBO J. 1991 Oct;10 (10) :2839-48.