Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIF, Human

LIF Protein, Human is a lymphoid factor involved in various neural and inflammatory processes such as the acute-phase reaction, tissue damage, and infection.

Product Specifications

Product Name Alternative

LIF Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/lif-protein-human.html

Purity

98.0

Smiles

SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Molecular Formula

3976 (Gene_ID) P15018-1 (S23-F202) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Metcalf D, et al. Effects of injected leukemia inhibitory factor on hematopoietic and other tissues in mice. Blood. 1990 Jul 1;76 (1) :50-6.|[2]Banner LR, et al. Leukemia inhibitory factor is an anti-inflammatory and analgesic cytokine. J Neurosci. 1998 Jul 15;18 (14) :5456-62.|[3]Gearing DP, et al. Leukemia inhibitory factor receptor is structurally related to the IL-6 signal transducer, gp130. EMBO J. 1991 Oct;10 (10) :2839-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Tyrosine Benzyl Ester
RG-T251802-01 10 mg

L-Tyrosine Benzyl Ester

Sign In for Pricing
View Details
L-Tyrosine Benzyl Ester
RG-T251802-02 25 mg

L-Tyrosine Benzyl Ester

Sign In for Pricing
View Details
L-Tyrosine Benzyl Ester
RG-T251802-03 50 mg

L-Tyrosine Benzyl Ester

Sign In for Pricing
View Details
L-Tyrosine Benzyl Ester
RG-T251802-04 100 mg

L-Tyrosine Benzyl Ester

Sign In for Pricing
View Details
CCDC50 Knockout AGS Polyclonal Cells
ARG43020 1 Million

CCDC50 Knockout AGS Polyclonal Cells

Sign In for Pricing
View Details
Htr1a (NM_012585) Rat Untagged Clone
RN212303 10 µg

Htr1a (NM_012585) Rat Untagged Clone

Sign In for Pricing
View Details