Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Oncomodulin-1, Human (His)

Oncomodulin-1 protein, exhibiting calmodulin-like activity, activates enzymes and regulates growth, binding two calcium ions and participating in calcium-mediated cellular processes. Oncomodulin-1 Protein, Human (His) is the recombinant human-derived Oncomodulin-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Oncomodulin-1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/oncomodulin-1-protein-human-his.html

Purity

95.0

Smiles

MSITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSANQVKDVFRFIDNDQSGYLDEEELKFFLQKFESGARELTESETKSLMAAADNDGDGKIGAEEFQEMVHS

Molecular Formula

654231 (Gene_ID) P0CE72 (M1-S109) (Accession)

Molecular Weight

Approximately 16.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RANK Polyclonal Antibody, Cy3 Conjugated
bs-43606R-Cy3 100 µL

RANK Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
BAP1 (Phospho-Ser369) Antibody
13268-01 50 µL

BAP1 (Phospho-Ser369) Antibody

Sign In for Pricing
View Details
BAP1 (Phospho-Ser369) Antibody
13268-02 100 µL

BAP1 (Phospho-Ser369) Antibody

Sign In for Pricing
View Details
2-Aminophenyl benzyl thioether
OR6654 1 Each

2-Aminophenyl benzyl thioether

Sign In for Pricing
View Details
RP2 (Retinitis Pigmentosa 2 (X-Linked Recessive), DELXp11.3, KIAA0215, TBCCD2) (FITC)
251238-FITC 100 µL

RP2 (Retinitis Pigmentosa 2 (X-Linked Recessive), DELXp11.3, KIAA0215, TBCCD2) (FITC)

Sign In for Pricing
View Details
DDX27 Lentiviral Activation Particles (h)
sc-409574-LAC 200 µL

DDX27 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details