Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD20/MS4A1, Human (Trx-His, Solution)

CD20/MS4A-1 Protein, Human (Trx-His) is an integral membrane protein expressed during B lymphocyte development.

Product Specifications

Product Name Alternative

CD20/MS4A1 Protein, Human (Trx-His, Solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd20-ms4a-1-protein-human-trx-his.html

Purity

96.15

Smiles

IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS

Molecular Formula

931 (Gene_ID) P11836-1 (I141-S188) (Accession)

Molecular Weight

18-22 kDa

References & Citations

[1]Anand Kumar, et al. Binding mechanisms of therapeutic antibodies to human CD20. Science. 2020 Aug 14;369 (6505) :793-799.|[2]Gabriela Pavlasova, et al. The regulation and function of CD20: an "enigma" of B-cell biology and targeted therapy. Haematologica. 2020 Jun;105 (6) :1494-1506.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thymine
GE5340-5g 5 g

Thymine

Sign In for Pricing
View Details
Trp53 Mouse qPCR Template Standard (NM_011640)
MK204778 1 Kit

Trp53 Mouse qPCR Template Standard (NM_011640)

Sign In for Pricing
View Details
MOAP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1314506 1.0 µg DNA

MOAP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Rat Dhps Pre-designed siRNA Set A
SI203762A 1 Each

Rat Dhps Pre-designed siRNA Set A

Sign In for Pricing
View Details
OR52B3P Protein Vector (Human) (pPM-C-HA)
35319021 500 ng

OR52B3P Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit Anti-phospho-NHE3 (Ser552) antibody
SL9582R-01 50 µL

Rabbit Anti-phospho-NHE3 (Ser552) antibody

Sign In for Pricing
View Details