Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD20/MS4A1, Human (Trx-His, Solution)

CD20/MS4A-1 Protein, Human (Trx-His) is an integral membrane protein expressed during B lymphocyte development.

Product Specifications

Product Name Alternative

CD20/MS4A1 Protein, Human (Trx-His, Solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd20-ms4a-1-protein-human-trx-his.html

Purity

96.15

Smiles

IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS

Molecular Formula

931 (Gene_ID) P11836-1 (I141-S188) (Accession)

Molecular Weight

18-22 kDa

References & Citations

[1]Anand Kumar, et al. Binding mechanisms of therapeutic antibodies to human CD20. Science. 2020 Aug 14;369 (6505) :793-799.|[2]Gabriela Pavlasova, et al. The regulation and function of CD20: an "enigma" of B-cell biology and targeted therapy. Haematologica. 2020 Jun;105 (6) :1494-1506.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PI 3 Kinase Class 2A (PIK3C2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D9]
TA801728AM 100 µL

PI 3 Kinase Class 2A (PIK3C2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D9]

Sign In for Pricing
View Details
alpha Actinin (ACTN1) (NM_001102) Human Recombinant Protein
TP304924 20 µg

alpha Actinin (ACTN1) (NM_001102) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue Total RNA, Colon: transverse
CR561519 5 µg

Tissue Total RNA, Colon: transverse

Sign In for Pricing
View Details
TIPRL Human Gene Knockout Kit (CRISPR)
KN201185BN 1 Kit

TIPRL Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (SPTBN2/1778), CF594 conjugate, 0.1mg/mL
BNC941778-100 1x 100 µL

Spectrin beta III (SPTBN2) (SPTBN2/1778), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2701), CF640R conjugate, 0.1mg/mL
BNC402701-100 1x 100 µL

RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2701), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details