Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD20/MS4A1, Human (Trx-His, Solution)

CD20/MS4A-1 Protein, Human (Trx-His) is an integral membrane protein expressed during B lymphocyte development.

Product Specifications

Product Name Alternative

CD20/MS4A1 Protein, Human (Trx-His, Solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd20-ms4a-1-protein-human-trx-his.html

Purity

96.15

Smiles

IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS

Molecular Formula

931 (Gene_ID) P11836-1 (I141-S188) (Accession)

Molecular Weight

18-22 kDa

References & Citations

[1]Anand Kumar, et al. Binding mechanisms of therapeutic antibodies to human CD20. Science. 2020 Aug 14;369 (6505) :793-799.|[2]Gabriela Pavlasova, et al. The regulation and function of CD20: an "enigma" of B-cell biology and targeted therapy. Haematologica. 2020 Jun;105 (6) :1494-1506.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ret (phospho Tyr1015) Polyclonal Antibody
13567-01 50 µL

Ret (phospho Tyr1015) Polyclonal Antibody

Sign In for Pricing
View Details
Ret (phospho Tyr1015) Polyclonal Antibody
13567-02 100 µL

Ret (phospho Tyr1015) Polyclonal Antibody

Sign In for Pricing
View Details
Rbm19 (NM_028762) Mouse Untagged Clone
MC201739 10 µg

Rbm19 (NM_028762) Mouse Untagged Clone

Sign In for Pricing
View Details
GIMAP8 Antibody
E310807 200 µL

GIMAP8 Antibody

Sign In for Pricing
View Details
GOSR1 Polyclonal Antibody, PE-Cy5 Conjugated
bs-13493R-PE-Cy5 100 µL

GOSR1 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Reagecon 0.5 mg/L C as Sodium Dodecylbenzene Sulfonate Total Organic Carbon (TOC) Standard for Analytik Jena Analyser
ISTOC1124 40 mL

Reagecon 0.5 mg/L C as Sodium Dodecylbenzene Sulfonate Total Organic Carbon (TOC) Standard for Analytik Jena Analyser

Sign In for Pricing
View Details