Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD20/MS4A1, Human (Trx-His, Solution)

CD20/MS4A-1 Protein, Human (Trx-His) is an integral membrane protein expressed during B lymphocyte development.

Product Specifications

Product Name Alternative

CD20/MS4A1 Protein, Human (Trx-His, Solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd20-ms4a-1-protein-human-trx-his.html

Purity

96.15

Smiles

IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS

Molecular Formula

931 (Gene_ID) P11836-1 (I141-S188) (Accession)

Molecular Weight

18-22 kDa

References & Citations

[1]Anand Kumar, et al. Binding mechanisms of therapeutic antibodies to human CD20. Science. 2020 Aug 14;369 (6505) :793-799.|[2]Gabriela Pavlasova, et al. The regulation and function of CD20: an "enigma" of B-cell biology and targeted therapy. Haematologica. 2020 Jun;105 (6) :1494-1506.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

LLGL1 Antibody
F53895-0.08ML 0.08 mL

LLGL1 Antibody

Ask
View Details
PIN4, NT (PIN4, Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4, Parvulin-14, Parvulin-17, Peptidyl-prolyl cis-trans isomerase Pin4, Peptidyl-prolyl cis/trans isomerase EPVH, Rotamase Pin4) (MaxLight 490)
MBS6334152-01 0.1 mL

PIN4, NT (PIN4, Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4, Parvulin-14, Parvulin-17, Peptidyl-prolyl cis-trans isomerase Pin4, Peptidyl-prolyl cis/trans isomerase EPVH, Rotamase Pin4) (MaxLight 490)

Ask
View Details
PIN4, NT (PIN4, Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4, Parvulin-14, Parvulin-17, Peptidyl-prolyl cis-trans isomerase Pin4, Peptidyl-prolyl cis/trans isomerase EPVH, Rotamase Pin4) (MaxLight 490)
MBS6334152-02 5x 0.1 mL

PIN4, NT (PIN4, Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4, Parvulin-14, Parvulin-17, Peptidyl-prolyl cis-trans isomerase Pin4, Peptidyl-prolyl cis/trans isomerase EPVH, Rotamase Pin4) (MaxLight 490)

Ask
View Details
Anti-LHX5 antibody
PAab04770 100 µg

Anti-LHX5 antibody

Ask
View Details
Rabbit anti-SMAD2 Recombinant Monoclonal Antibody [BLR130H]
MBS3906425-01 0.1 mg

Rabbit anti-SMAD2 Recombinant Monoclonal Antibody [BLR130H]

Ask
View Details
Rabbit anti-SMAD2 Recombinant Monoclonal Antibody [BLR130H]
MBS3906425-02 5x 0.1 mg

Rabbit anti-SMAD2 Recombinant Monoclonal Antibody [BLR130H]

Ask
View Details