Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Solute carrier family 2, facilitated glucose transporter member 1 (Slc2a1), partial

Product Specifications

Product Name Alternative

Glucose transporter type 1, erythrocyte/brain

Abbreviation

Recombinant Mouse Slc2a1 protein, partial

Gene Name

Slc2a1

UniProt

P17809

Expression Region

451-492aa

Organism

Mus musculus (Mouse)

Target Sequence

KVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADSQV

Tag

Tag-Free

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Facilitative glucose transporter, which is responsible for constitutive or basal glucose uptake (PubMed:17320047) . Has a very broad substrate specificity; can transport a wide range of aldoses including both pentoses and hexoses (By similarity) . Most important energy carrier of the brain: present at the blood-brain barrier and assures the energy-independent, facilitative transport of glucose into the brain (By similarity) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

4.5 kDa

References & Citations

"Implications of glucose transporter protein type 1 (GLUT1) -haplodeficiency in embryonic stem cells for their survival in response to hypoxic stress." Heilig C., Brosius F., Siu B., Concepcion L., Mortensen R., Heilig K., Zhu M., Weldon R., Wu G., Conner D. Am. J. Pathol. 163:1873-1885 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL
BNC740009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL
BNC040043-100 1x 100 µL

P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF405S conjugate, 0.1mg/mL
BNC040177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM Immunoglobulin (DA4-4), CF488A conjugate, 0.1mg/mL
BNC880759-500 1x 500 µL

Human IgM Immunoglobulin (DA4-4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1993), CF568 conjugate, 0.1mg/mL
BNC681993-100 1x 100 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1993), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL
BNC940525-100 1x 100 µL

CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details