AK1, Human (His-SUMO)

The AK1 protein contributes to cellular energy dynamics by catalyzing the reversible transfer of terminal phosphate groups between ATP and AMP. In addition to its primary role, AK1 exhibits nucleoside diphosphate kinase activity, utilizing ATP or GTP as a phosphate donor to generate ATP, CTP, GTP, UTP, dATP, dCTP, dGTP, and dTTP. AK1 Protein, Human (His-SUMO) is the recombinant human-derived AK1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of AK1 Protein, Human (His-SUMO) is 194 a.a., with molecular weight of 37.6 kDa.

MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK