Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Protransforming growth factor alpha (Tgfa)

Product Specifications

Abbreviation

Recombinant Rat Tgfa protein

Gene Name

Tgfa

UniProt

P01134

Expression Region

24-159aa

Organism

Rattus norvegicus (Rat)

Target Sequence

ENSTSPLSDSPVAAAVVSHFNKCPDSHTQYCFHGTCRFLVQEEKPACVCHSGYVGVRCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALVCRHEKPSALLKGRTACCHSETVV

Tag

N-terminal 6xHis-KSI-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.1 kDa

References & Citations

"Transforming growth factor-alpha attenuates N-methyl-D-aspartic acid toxicity in cortical cultures by preventing protein synthesis inhibition through an Erk1/2-dependent mechanism." Petegnief V., Friguls B., Sanfeliu C., Sunol C., Planas A.M. J Biol Chem 278:29552-29559 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ptgs2 Mouse Gene Knockout Kit (CRISPR)
KN314183RB 1 Kit

Ptgs2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
rac Matairesinol
TRC-M197850-5MG 5 mg

rac Matairesinol

Sign In for Pricing
View Details
SORBS2 (NM_001145675) Human Over-expression Lysate
LC428972 20 µg

SORBS2 (NM_001145675) Human Over-expression Lysate

Sign In for Pricing
View Details
2-[(Chloroacetyl)amino]benzoic Acid
TRC-B418338-25MG 25 mg

2-[(Chloroacetyl)amino]benzoic Acid

Sign In for Pricing
View Details
Recombinant Human XEDAR/EDA2R Protein (His Tag)
PKSH030983 100 µg

Recombinant Human XEDAR/EDA2R Protein (His Tag)

Sign In for Pricing
View Details
CD45RB (PD7/26), CF405S conjugate, 0.1mg/mL
BNC040472-500 1x 500 µL

CD45RB (PD7/26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details