Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor ligand superfamily member 4 (TNFSF4), partial

Product Specifications

Product Name Alternative

Glycoprotein Gp34; OX40 ligand (OX40L) ; TAX transcriptionally-activated glycoprotein 1

Abbreviation

Recombinant Human TNFSF4 protein, partial

Gene Name

TNFSF4

UniProt

P23510

Expression Region

51-183aa

Organism

Homo sapiens (Human)

Target Sequence

QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial of Isoform 2

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MLNR Pre-designed siRNA Set B
SI009644B 1 Each

Human MLNR Pre-designed siRNA Set B

Sign In for Pricing
View Details
Anti-CD18 antibody
STJ16100057 100 µg

Anti-CD18 antibody

Sign In for Pricing
View Details
C6 (B-3) : m-IgG1 BP-HRP Bundle
sc-542408 1 Kit

C6 (B-3) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
Chicken pNFkB ELISA Kit
ECKP0029 96 Tests

Chicken pNFkB ELISA Kit

Sign In for Pricing
View Details
PPEF1 (PPEF-1, Serine/Threonine Protein Phosphatase with EF-hands-1, Protein Phosphatase with EF Calcium-binding Domain, PPEF, Serine/Threonine-protein Phosphatase 7, PP7, PPEF, PPP7C) (FITC)
131652-FITC 100 µL

PPEF1 (PPEF-1, Serine/Threonine Protein Phosphatase with EF-hands-1, Protein Phosphatase with EF Calcium-binding Domain, PPEF, Serine/Threonine-protein Phosphatase 7, PP7, PPEF, PPP7C) (FITC)

Sign In for Pricing
View Details
CLC2 (Clcn2, Chloride Channel)
C5837-05E 100 µg

CLC2 (Clcn2, Chloride Channel)

Sign In for Pricing
View Details