SDF-1 alpha/CXCL12, Human (His)
SDF-1 alpha (Stromal Cell-Derived Factor-1α, SDF-1α) is a member of the chemokine α subfamily that lack the ELR domain. SDF-1α works as a chemoattractant for T- and B-lymphocytes and monocytes. SDF-1α is a ligand for CXCR4. The SDF-1α/CXCR4 signaling mediates many physiological processes including cell trafficking, angiogenesis, embryogenesis, tumor invasion and metastatic. It also controls the chemotaxis of hematopoietic stem cells homing to the bone marrow[1][2]. SDF-1 alpha/CXCL12 Protein, Human (His) is produced in E. coli with a N-Terminal His-tag. It consists of 68 amino acids (K22-K89) .
Product Specifications
Product Name Alternative
SDF-1 alpha/CXCL12 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/sdf-1-alpha-protein-human-his.html
Purity
98.0
Smiles
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Molecular Formula
6387 (Gene_ID) P48061-2 (K22-K89) (Accession)
Molecular Weight
Approximately 10-13 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog