Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17D, Human

IL-17D protein acts as a potent inducer, effectively triggering endothelial cells to express key inflammatory mediators such as IL6, CXCL8/IL8, and CSF2/GM-CSF. The ability of this cytokine to stimulate the production of pro-inflammatory signals emphasizes its importance in orchestrating immune responses, particularly in the context of endothelial cell activation. IL-17D Protein, Human is the recombinant human-derived IL-17D protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-17D Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17d-protein-human.html

Purity

98.0

Smiles

APRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP

Molecular Formula

53342 (Gene_ID) Q8TAD2 (A18-P202) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPTE (Transmembrane Phosphatase with Tensin Homology, Cancer/Testis Antigen 44, CT44, PTEN2, Putative Tyrosine Protein Phosphatase, Tumor Antigen BJ-HCC-5) (FITC)
138464-FITC 100 µL

TPTE (Transmembrane Phosphatase with Tensin Homology, Cancer/Testis Antigen 44, CT44, PTEN2, Putative Tyrosine Protein Phosphatase, Tumor Antigen BJ-HCC-5) (FITC)

Sign In for Pricing
View Details
1-Bromo-4-(4-chlorophenyl)butan-2-one
TRC-B681820-50MG 50 mg

1-Bromo-4-(4-chlorophenyl)butan-2-one

Sign In for Pricing
View Details
CD38 Mouse Monoclonal Antibody [Clone 1C9]
E45M16522V-2 50 µL

CD38 Mouse Monoclonal Antibody [Clone 1C9]

Sign In for Pricing
View Details
OC90 (NM_001080399) Human Tagged Lenti ORF Clone
RC221622L4 10 µg

OC90 (NM_001080399) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Human CD42b/GP1BA Protein, C-Fc
MBS1581897-01 0.1 mg

Recombinant Human CD42b/GP1BA Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Human CD42b/GP1BA Protein, C-Fc
MBS1581897-02 1 mg

Recombinant Human CD42b/GP1BA Protein, C-Fc

Sign In for Pricing
View Details