CNTF, Human (His)
CNTF is a pluripotent neurotrophic factor, belonging to the IL-6 cytokine family[1]. CNTF could protect retinal cone and rod photoreceptors[2]. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons[3]. CNTF Protein, Human (His) is produced by E. coli (A2-M200) with N-terminal His-tag.
Product Specifications
Product Name Alternative
CNTF Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cntf-protein-human-his.html
Purity
97.50
Smiles
AFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
Molecular Formula
1270 (Gene_ID) P26441 (A2-M200) (Accession)
Molecular Weight
27-30 kDa
References & Citations
[1]Jones SA, et al. Recent insights into targeting the IL-6 cytokine family in inflammatory diseases and cancer. Nat Rev Immunol. 2018 Dec;18 (12) :773-789.|[2]Li S, et al. Ciliary neurotrophic factor (CNTF) protects retinal cone and rod photoreceptors by suppressing excessive formation of the visual pigments. J Biol Chem. 2018 Sep 28;293 (39) :15256-15268.|[3]Abbaszadeh HA, et al. Human ciliary neurotrophic factor-overexpressing stable bone marrow stromal cells in the treatment of a rat model of traumatic spinal cord injury. Cytotherapy. 2015 Jul;17 (7) :912-21.|[4]Zurn A D, et al. Combined effects of GDNF, BDNF, and CNTF on motoneuron differentiation in vitro[J]. Journal of neuroscience research, 1996, 44 (2) : 133-141.
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ARP44575_P050-Biotin 100 µL
KIAA1754L Antibody - C-terminal region : Biotin (ARP44575_P050-Biotin)
Sign In for Pricing
View Details 
TL509138V 500 µL Each
Prl3d1 Mouse shRNA Lentiviral Particle (Locus ID 18775)
Sign In for Pricing
View Details 