Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-18BP, Mouse (HEK293, Fc)

IL-18BP protein regulates immune processes by binding to interleukin-18 (IL-18), inhibiting its activity. This interaction positions IL-18BP as a key inhibitor of the early TH1 cytokine response, emphasizing its role in immune modulation and potential contribution to regulating inflammatory responses. IL-18BP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL-18BP protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

IL-18BP Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-18bp-protein-mouse-hek293-fc.html

Purity

98.0

Smiles

TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA

Molecular Formula

16068 (Gene_ID) Q9Z0M9 (T29-A193) (Accession)

Molecular Weight

Approximately 60-90 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-L-Lys (N3-Aca-DIM) -OH
HY-151787 1 Each

Fmoc-L-Lys (N3-Aca-DIM) -OH

Sign In for Pricing
View Details
(Tyr0) -Apelin-13 (human, bovine, mouse, rat)
FT109394-01 1000 µg

(Tyr0) -Apelin-13 (human, bovine, mouse, rat)

Sign In for Pricing
View Details
(Tyr0) -Apelin-13 (human, bovine, mouse, rat)
FT109394-02 2000 µg

(Tyr0) -Apelin-13 (human, bovine, mouse, rat)

Sign In for Pricing
View Details
(Tyr0) -Apelin-13 (human, bovine, mouse, rat)
FT109394-03 5000 μg

(Tyr0) -Apelin-13 (human, bovine, mouse, rat)

Sign In for Pricing
View Details
Monkey Serine/Threonine-Protein Kinase NLK (NLK) ELISA Kit
MBS9346189-01 48 Well

Monkey Serine/Threonine-Protein Kinase NLK (NLK) ELISA Kit

Sign In for Pricing
View Details
Monkey Serine/Threonine-Protein Kinase NLK (NLK) ELISA Kit
MBS9346189-02 96 Well

Monkey Serine/Threonine-Protein Kinase NLK (NLK) ELISA Kit

Sign In for Pricing
View Details