Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Muellerian-inhibiting factor (Amh), partial

Product Specifications

Product Name Alternative

Anti-Muellerian hormone ; AMH; Muellerian-inhibiting substance ; MIS

Abbreviation

Recombinant Mouse Amh protein, partial

Gene Name

Amh

UniProt

P27106

Expression Region

450-552aa

Organism

Mus musculus (Mouse)

Target Sequence

DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.4 kDa

References & Citations

Expression of the mouse anti-Mullerian hormone gene suggests a role in both male and female sexual differentiation.Muensterberg A., Lovell-Badge R.Development 113:613-624 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUN2 Human Gene Knockout Kit (CRISPR)
KN422038 1 Kit

SUN2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Car8 Mouse Gene Knockout Kit (CRISPR)
KN502539 1 Kit

Car8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AGA Human Gene Knockout Kit (CRISPR)
KN401975 1 Kit

AGA Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PRLHR Polyclonal Antibody
E-AB-90181-01 60 µL

PRLHR Polyclonal Antibody

Sign In for Pricing
View Details
PRLHR Polyclonal Antibody
E-AB-90181-02 120 µL

PRLHR Polyclonal Antibody

Sign In for Pricing
View Details
PRLHR Polyclonal Antibody
E-AB-90181-03 200 µL

PRLHR Polyclonal Antibody

Sign In for Pricing
View Details