Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Naja atra Cytotoxin 2

Product Specifications

Product Name Alternative

Cardiotoxin 1A; Cardiotoxin 2; CTX-2; Cardiotoxin A2; CTX A2; Cardiotoxin II; Cardiotoxin analog II

Abbreviation

Recombinant Naja atra Cytotoxin 2 protein

UniProt

P01442

Expression Region

22-81aa

Organism

Naja atra (Chinese cobra)

Target Sequence

LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF568 conjugate, 0.1mg/mL
BNC680861-100 1x 100 µL

HSP27 (G3.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF594 conjugate, 0.1mg/mL
BNC940449-500 1x 500 µL

CD104 (UM-A9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF594 conjugate, 0.1mg/mL
BNC940160-100 1x 100 µL

CD20 (B9E9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Plasma Cell Marker (LIV3G11, same as 7B18), CF568 conjugate, 0.1mg/mL
BNC680047-100 1x 100 µL

Plasma Cell Marker (LIV3G11, same as 7B18), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (H1 + TS1), CF640R conjugate, 0.1mg/mL
BNC400687-100 1x 100 µL

Cytokeratin 8 (H1 + TS1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ARF1 (Golgi Apparatus Marker) (3F1), CF405S conjugate, 0.1mg/mL
BNC042029-500 1x 500 µL

ARF1 (Golgi Apparatus Marker) (3F1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details