Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAM5) (E398K) (Active)

Product Specifications

Product Name Alternative

(Carcinoembryonic antigen) (CEA) (Meconium antigen 100) (CD antigen CD66e)

Abbreviation

Recombinant Human CEACAM5 protein (E398K) (Active)

Gene Name

CEACAM5

UniProt

P06731

Expression Region

35-685aa (E398K)

Organism

Homo sapiens (Human)

Target Sequence

KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Cell surface glycoprotein that plays a role in cell adhesion, intracellular signaling and tumor progression (PubMed:2803308, PubMed:10910050, PubMed:10864933) . Mediates homophilic and heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6. Plays a role as an oncogene by promoting tumor progression; induces resistance to anoikis of colorectal carcinoma cells

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM5 at 2μg/mL can bind Anti-CEACAM5 recombinant antibody (CSB-RA005165MA1HU), the EC50 is 0.8955-1.719 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

74.1 kDa

References & Citations

Cell surface glycoprotein that plays a role in cell adhesion, intracellular signaling and tumor progression . Mediates homophilic and heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6. Plays a role as an oncogene by promoting tumor progression; induces resistance to anoikis of colorectal carcinoma cells .; (Microbial infection) Receptor for E.coli Dr adhesins. Binding of E.coli Dr adhesins leads to dissociation of the homodimer.

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12933684/

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-Hemoglobin (Human) Mouse Monoclonal Antibody - Library Pack
190101 1 Each

Anti-Hemoglobin (Human) Mouse Monoclonal Antibody - Library Pack

Ask
View Details
FITC-Linked Polyclonal Antibody to Absent In Melanoma 2 (AIM2)
MBS2077764-01 0.1 mL

FITC-Linked Polyclonal Antibody to Absent In Melanoma 2 (AIM2)

Ask
View Details
FITC-Linked Polyclonal Antibody to Absent In Melanoma 2 (AIM2)
MBS2077764-02 0.2 mL

FITC-Linked Polyclonal Antibody to Absent In Melanoma 2 (AIM2)

Ask
View Details
FITC-Linked Polyclonal Antibody to Absent In Melanoma 2 (AIM2)
MBS2077764-03 0.5 mL

FITC-Linked Polyclonal Antibody to Absent In Melanoma 2 (AIM2)

Ask
View Details
FITC-Linked Polyclonal Antibody to Absent In Melanoma 2 (AIM2)
MBS2077764-04 1 mL

FITC-Linked Polyclonal Antibody to Absent In Melanoma 2 (AIM2)

Ask
View Details
FITC-Linked Polyclonal Antibody to Absent In Melanoma 2 (AIM2)
MBS2077764-05 5 mL

FITC-Linked Polyclonal Antibody to Absent In Melanoma 2 (AIM2)

Ask
View Details