What is the catalog number for AIF1, Mouse (His)?

The catalog number for AIF1, Mouse (His) is HY-P72075.

What sizes are available for AIF1, Mouse (His)?

AIF1, Mouse (His) is available in the following size(s): 50 µg.

Is AIF1, Mouse (His) in stock?

AIF1, Mouse (His) is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures AIF1, Mouse (His)?

AIF1, Mouse (His) is manufactured by QuantiMol.

What is the estimated delivery time for AIF1, Mouse (His)?

Estimated delivery time for AIF1, Mouse (His) is approximately 15 business day(s), depending on your location.

AIF1, Mouse (His)

AIF1 Protein, Mouse (His) is an actin-polymerizing and Rac1-activating protein that promotes vascular smooth muscle cell migration.

Product Specifications

Product Name Alternative

AIF1 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/aif1-protein-mouse-his.html

Purity

93.00

Smiles

SQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHKRPTGPPAKKAISELP

Molecular Formula

11629 (Gene_ID) O70200 (S2-P147) (Accession)

Molecular Weight

Approximately 24 kDa

References & Citations

[1]Autieri MV, et, al. AIF-1 is an actin-polymerizing and Rac1-activating protein that promotes vascular smooth muscle cell migration. Circ Res. 2003 May 30;92 (10) :1107-14.|[2]Kishikawa S, et, al. Allograft inflammatory factor 1 is a regulator of transcytosis in M cells. Nat Commun. 2017 Feb 22;8:14509.