Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lama glama Interleukin-2 (IL2)

Product Specifications

Product Name Alternative

(IL-2) (T-cell growth factor) (TCGF)

Abbreviation

Recombinant Lama glama IL2 protein

Gene Name

IL2

UniProt

Q865X2

Expression Region

21-154aa

Organism

Lama glama (Llama)

Target Sequence

APTLSSTKDTKKQLEPLLLDLQFLLKEVNNYENLKLSRMLTFKFYMPKKATELKHLQCLMEELKPLEEVLNLAQSKNSHLTNIKDSMNNINLTVSELKGSETGFTCEYDDETVTVVEFLNKWITFCQSIYSTMT

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.6 kDa

References & Citations

"Requirement for p38alpha in erythropoietin expression: a role for stress kinases in erythropoiesis." Tamura K., Sudo T., Senftleben U., Dadak A.M., Johnson R., Karin M. Cell 102:221-231 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycerophospho-N-Arachidonoyl Ethanolamine Sodium Salt
TRC-G598650-2.5MG 2.5 mg

Glycerophospho-N-Arachidonoyl Ethanolamine Sodium Salt

Sign In for Pricing
View Details
Acsm1 Mouse Gene Knockout Kit (CRISPR)
KN500762 1 Kit

Acsm1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (rTGB24), CF405S conjugate, 0.1mg/mL
BNC041967-500 1x 500 µL

Thyroglobulin (Thyroidal Cell Marker) (rTGB24), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ICOS Mouse Monoclonal Antibody [Clone ID: OTI5B7]
CF813209 100 µg

ICOS Mouse Monoclonal Antibody [Clone ID: OTI5B7]

Sign In for Pricing
View Details
EDTA, AM ester
19010-AAT 10x 50 µg

EDTA, AM ester

Sign In for Pricing
View Details
Epoxide hydrolase (EPHX1) (NM_001136018) Human Over-expression Lysate
LY427767 100 µg

Epoxide hydrolase (EPHX1) (NM_001136018) Human Over-expression Lysate

Sign In for Pricing
View Details