Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lama glama Interleukin-2 (IL2)

Product Specifications

Product Name Alternative

(IL-2) (T-cell growth factor) (TCGF)

Abbreviation

Recombinant Lama glama IL2 protein

Gene Name

IL2

UniProt

Q865X2

Expression Region

21-154aa

Organism

Lama glama (Llama)

Target Sequence

APTLSSTKDTKKQLEPLLLDLQFLLKEVNNYENLKLSRMLTFKFYMPKKATELKHLQCLMEELKPLEEVLNLAQSKNSHLTNIKDSMNNINLTVSELKGSETGFTCEYDDETVTVVEFLNKWITFCQSIYSTMT

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.6 kDa

References & Citations

"Requirement for p38alpha in erythropoietin expression: a role for stress kinases in erythropoiesis." Tamura K., Sudo T., Senftleben U., Dadak A.M., Johnson R., Karin M. Cell 102:221-231 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CaSR Recombinant Rabbit Monoclonal Antibody [PSH03-47]
HA722006 100 µL

CaSR Recombinant Rabbit Monoclonal Antibody [PSH03-47]

Sign In for Pricing
View Details
OR14J1 (C-term) Rabbit Polyclonal Antibody
AP53020PU-N 400 µL

OR14J1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PLEKHG4B (NM_052909) Human Recombinant Protein
TP313285L 1 mg

PLEKHG4B (NM_052909) Human Recombinant Protein

Sign In for Pricing
View Details
RBP4 (NM_006744) Human Recombinant Protein
TP304635L 1 mg

RBP4 (NM_006744) Human Recombinant Protein

Sign In for Pricing
View Details
Human MZT2B activation kit by CRISPRa
GA112815 1 Kit

Human MZT2B activation kit by CRISPRa

Sign In for Pricing
View Details
Micro Centrifuge Tubes
C2000 500 Sheets/Pack

Micro Centrifuge Tubes

Sign In for Pricing
View Details