Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A8, Human (C-His)

S100A8 consists of calcium and zinc bound S100A8, which plays a critical regulatory role in inflammation and immune responses. As calprotectin, it contributes to leukocyte function, regulates the cytoskeleton, and activates intracellular NADPH oxidase. S100A8 Protein, Human (C-His) is the recombinant human-derived S100A8 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A8 Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a8-protein-human-c-his.html

Purity

98.0

Smiles

MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

Molecular Formula

6279 (Gene_ID) P05109 (M1-E93) (Accession)

Molecular Weight

Approximately 13.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kcnj3 ORF Vector (Rat) (pORF)
25384016 1.0 µg DNA

Kcnj3 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Anti-Muscarinic Acetylcholine Receptor 2/CHRM2 Antibody Picoband®, APC Conjugate
PA1325-1-APC 100 µg/Vial

Anti-Muscarinic Acetylcholine Receptor 2/CHRM2 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
Rabbit anti-p65 (pT60) Antibody
YLD5887-01 50 µL

Rabbit anti-p65 (pT60) Antibody

Sign In for Pricing
View Details
Rabbit anti-p65 (pT60) Antibody
YLD5887-02 100 µL

Rabbit anti-p65 (pT60) Antibody

Sign In for Pricing
View Details
PDCL3P1 AAV Vector (Human) (CMV)
36271101 1 µg

PDCL3P1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Recombinant Gorilla gorilla gorilla Cytochrome c oxidase subunit 3 (MT-CO3), partial
MBS7102104 Inquire

Recombinant Gorilla gorilla gorilla Cytochrome c oxidase subunit 3 (MT-CO3), partial

Sign In for Pricing
View Details