Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-9, Human (HEK293, Fc, solution)

Activin AB protein is a member of the transforming growth factor-β (TGF-β) superfamily and plays a key role in various biological processes such as cell differentiation, proliferation, and apoptosis. It is involved in embryonic development, tissue repair and immune regulation. FGF-9 Protein, Human (HEK293, Fc, solution) is the recombinant human-derived FGF-9 protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

FGF-9 Protein, Human (HEK293, Fc, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-9-protein-human-hek293-fc.html

Purity

93.50

Smiles

LGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Molecular Formula

2254 (Gene_ID) NP_002001.1 (L4-S208) (Accession)

Molecular Weight

Approximately 54 kDa & 37 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF594 conjugate, 0.1mg/mL
BNC940146-100 1x 100 µL

CD10 (CB-CALLA), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF640R conjugate, 0.1mg/mL
BNC400151-500 1x 500 µL

CD11a (Cris-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF640R conjugate, 0.1mg/mL
BNC400851-100 1x 100 µL

HSP60 (LK1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), 0.2mg/mL
BNUB1231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), 0.2mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), Biotin conjugate, 0.1mg/mL
BNCB0204-100 1x 100 µL

Complement C4d (C4D204), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details