Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-9, Human (HEK293, Fc, solution)

Activin AB protein is a member of the transforming growth factor-β (TGF-β) superfamily and plays a key role in various biological processes such as cell differentiation, proliferation, and apoptosis. It is involved in embryonic development, tissue repair and immune regulation. FGF-9 Protein, Human (HEK293, Fc, solution) is the recombinant human-derived FGF-9 protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

FGF-9 Protein, Human (HEK293, Fc, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-9-protein-human-hek293-fc.html

Purity

93.50

Smiles

LGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Molecular Formula

2254 (Gene_ID) NP_002001.1 (L4-S208) (Accession)

Molecular Weight

Approximately 54 kDa & 37 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTTP (C-term) Rabbit Polyclonal Antibody
AP52771PU-N 400 µL

MTTP (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UBA2 Human Gene Knockout Kit (CRISPR)
KN401288 1 Kit

UBA2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human LAG3/CD223 Protein (mFc Tag)
PKSH033595-01 10 µg

Recombinant Human LAG3/CD223 Protein (mFc Tag)

Sign In for Pricing
View Details
Recombinant Human LAG3/CD223 Protein (mFc Tag)
PKSH033595-02 50 µg

Recombinant Human LAG3/CD223 Protein (mFc Tag)

Sign In for Pricing
View Details
Recombinant TRIM21 Antibody
RC-007-01 50 μL

Recombinant TRIM21 Antibody

Sign In for Pricing
View Details
Recombinant TRIM21 Antibody
RC-007-02 100 µL

Recombinant TRIM21 Antibody

Sign In for Pricing
View Details