Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-9, Human (HEK293, Fc, solution)

Activin AB protein is a member of the transforming growth factor-β (TGF-β) superfamily and plays a key role in various biological processes such as cell differentiation, proliferation, and apoptosis. It is involved in embryonic development, tissue repair and immune regulation. FGF-9 Protein, Human (HEK293, Fc, solution) is the recombinant human-derived FGF-9 protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

FGF-9 Protein, Human (HEK293, Fc, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-9-protein-human-hek293-fc.html

Purity

93.50

Smiles

LGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Molecular Formula

2254 (Gene_ID) NP_002001.1 (L4-S208) (Accession)

Molecular Weight

Approximately 54 kDa & 37 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human ZC3H7A sgRNA gene knockout kit - Lentiviral human ZC3H7A sgRNA gene knockout kit (100)
GTR15368149 1 Vial

Lentiviral human ZC3H7A sgRNA gene knockout kit - Lentiviral human ZC3H7A sgRNA gene knockout kit (100)

Ask
View Details
Mouse Monoclonal LEPRE1 Antibody (OTI1H3) [DyLight 350]
NBP2-72134UV 0.1 mL

Mouse Monoclonal LEPRE1 Antibody (OTI1H3) [DyLight 350]

Ask
View Details
Rabbit Polyclonal ADAR Antibody (Human, Mouse, Rat)
B2020592 100 µL

Rabbit Polyclonal ADAR Antibody (Human, Mouse, Rat)

Ask
View Details
Rabbit Polyclonal TOR/mTOR Antibody [Alexa Fluor 405]
NB100-240AF405 100 µL

Rabbit Polyclonal TOR/mTOR Antibody [Alexa Fluor 405]

Ask
View Details