Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-9, Human (HEK293, Fc, solution)

Activin AB protein is a member of the transforming growth factor-β (TGF-β) superfamily and plays a key role in various biological processes such as cell differentiation, proliferation, and apoptosis. It is involved in embryonic development, tissue repair and immune regulation. FGF-9 Protein, Human (HEK293, Fc, solution) is the recombinant human-derived FGF-9 protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

FGF-9 Protein, Human (HEK293, Fc, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-9-protein-human-hek293-fc.html

Purity

93.50

Smiles

LGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Molecular Formula

2254 (Gene_ID) NP_002001.1 (L4-S208) (Accession)

Molecular Weight

Approximately 54 kDa & 37 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Ppp4r4 (NM_028980) Mouse Untagged Clone
MC222334 10 µg

Ppp4r4 (NM_028980) Mouse Untagged Clone

Ask
View Details
TBRG1, NT (Transforming Growth Factor beta Regulator 1, Nuclear Interactor of ARF and Mdm2, NIAM) (FITC)
MBS6503402-01 0.2 mL

TBRG1, NT (Transforming Growth Factor beta Regulator 1, Nuclear Interactor of ARF and Mdm2, NIAM) (FITC)

Ask
View Details
TBRG1, NT (Transforming Growth Factor beta Regulator 1, Nuclear Interactor of ARF and Mdm2, NIAM) (FITC)
MBS6503402-02 5x 0.2 mL

TBRG1, NT (Transforming Growth Factor beta Regulator 1, Nuclear Interactor of ARF and Mdm2, NIAM) (FITC)

Ask
View Details
Lentiviral mouse Ttl shRNA (UAS) - Lentiviral mouse Ttl shRNA (UAS, GFP) (100)
GTR15230733 1 Vial

Lentiviral mouse Ttl shRNA (UAS) - Lentiviral mouse Ttl shRNA (UAS, GFP) (100)

Ask
View Details
Monkey Monoclonal Monkeypox Virus A29L Antibody (0031) [Alexa Fluor 405]
NBP3-18271AF405 0.1 mL

Monkey Monoclonal Monkeypox Virus A29L Antibody (0031) [Alexa Fluor 405]

Ask
View Details