Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-9, Human (HEK293, Fc, solution)

Activin AB protein is a member of the transforming growth factor-β (TGF-β) superfamily and plays a key role in various biological processes such as cell differentiation, proliferation, and apoptosis. It is involved in embryonic development, tissue repair and immune regulation. FGF-9 Protein, Human (HEK293, Fc, solution) is the recombinant human-derived FGF-9 protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

FGF-9 Protein, Human (HEK293, Fc, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-9-protein-human-hek293-fc.html

Purity

93.50

Smiles

LGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Molecular Formula

2254 (Gene_ID) NP_002001.1 (L4-S208) (Accession)

Molecular Weight

Approximately 54 kDa & 37 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rnf186 (NM_001109592) Rat Tagged ORF Clone Lentiviral Particle
RR203626L3V 200 µL

Rnf186 (NM_001109592) Rat Tagged ORF Clone Lentiviral Particle

Ask
View Details
Tdpoz2 Mouse shRNA Lentiviral Particle (Locus ID 399673)
TL510942V 500 µL Each

Tdpoz2 Mouse shRNA Lentiviral Particle (Locus ID 399673)

Ask
View Details
Monkey Ras homolog gene family, memmber B ELISA Kit
MBS747992-01 48 Well

Monkey Ras homolog gene family, memmber B ELISA Kit

Ask
View Details
Monkey Ras homolog gene family, memmber B ELISA Kit
MBS747992-02 96 Well

Monkey Ras homolog gene family, memmber B ELISA Kit

Ask
View Details
Monkey Ras homolog gene family, memmber B ELISA Kit
MBS747992-03 5x 96 Well

Monkey Ras homolog gene family, memmber B ELISA Kit

Ask
View Details
Monkey Ras homolog gene family, memmber B ELISA Kit
MBS747992-04 10x 96 Well

Monkey Ras homolog gene family, memmber B ELISA Kit

Ask
View Details