Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-9, Human (HEK293, Fc, solution)

Activin AB protein is a member of the transforming growth factor-β (TGF-β) superfamily and plays a key role in various biological processes such as cell differentiation, proliferation, and apoptosis. It is involved in embryonic development, tissue repair and immune regulation. FGF-9 Protein, Human (HEK293, Fc, solution) is the recombinant human-derived FGF-9 protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

FGF-9 Protein, Human (HEK293, Fc, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-9-protein-human-hek293-fc.html

Purity

93.50

Smiles

LGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Molecular Formula

2254 (Gene_ID) NP_002001.1 (L4-S208) (Accession)

Molecular Weight

Approximately 54 kDa & 37 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TLR2 Recombinant Rabbit monoclonal Antibody [JM22-41]
ET1705-92-50UL 50 µL

TLR2 Recombinant Rabbit monoclonal Antibody [JM22-41]

Ask
View Details
Mouse Monoclonal Herpes Simplex Virus 1 (HSV1) Antibody (HSVI/2095) [FITC]
NBP3-08465F 100 µL

Mouse Monoclonal Herpes Simplex Virus 1 (HSV1) Antibody (HSVI/2095) [FITC]

Ask
View Details
Lentiviral mouse Npy5r shRNA (UAS) - Lentiviral mouseNpy5r shRNA (UAS, GFP) (25)
GTR15220880 1 Vial

Lentiviral mouse Npy5r shRNA (UAS) - Lentiviral mouseNpy5r shRNA (UAS, GFP) (25)

Ask
View Details
Tissue, Section, Human Disease, Alzheimer's Disease, Brain, Thalamus (Frozen)
MBS640320-01 5 Sections

Tissue, Section, Human Disease, Alzheimer's Disease, Brain, Thalamus (Frozen)

Ask
View Details
Tissue, Section, Human Disease, Alzheimer's Disease, Brain, Thalamus (Frozen)
MBS640320-02 5x 5 Sections

Tissue, Section, Human Disease, Alzheimer's Disease, Brain, Thalamus (Frozen)

Ask
View Details