Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-9, Human (HEK293, Fc, solution)

Activin AB protein is a member of the transforming growth factor-β (TGF-β) superfamily and plays a key role in various biological processes such as cell differentiation, proliferation, and apoptosis. It is involved in embryonic development, tissue repair and immune regulation. FGF-9 Protein, Human (HEK293, Fc, solution) is the recombinant human-derived FGF-9 protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

FGF-9 Protein, Human (HEK293, Fc, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-9-protein-human-hek293-fc.html

Purity

93.50

Smiles

LGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Molecular Formula

2254 (Gene_ID) NP_002001.1 (L4-S208) (Accession)

Molecular Weight

Approximately 54 kDa & 37 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PHF12, CT (PHF12, KIAA1523, PHD finger protein 12, PHD factor 1) (MaxLight 405) discontinued
039941-ML405 100 µL

PHF12, CT (PHF12, KIAA1523, PHD finger protein 12, PHD factor 1) (MaxLight 405) discontinued

Ask
View Details
Tryptone Glucose Yeast Broth Medium
LA5520 250 g

Tryptone Glucose Yeast Broth Medium

Ask
View Details
Human NLRP12 Knockout HEK293T cell line
GTR15421095 1 Vial

Human NLRP12 Knockout HEK293T cell line

Ask
View Details
Box of 100 Sterile Mce Membranes 0.22µm, Black Gridded, 50 Mm
MF050ME022GSC Box of 100

Box of 100 Sterile Mce Membranes 0.22µm, Black Gridded, 50 Mm

Ask
View Details