Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-9, Human (HEK293, Fc, solution)

Activin AB protein is a member of the transforming growth factor-β (TGF-β) superfamily and plays a key role in various biological processes such as cell differentiation, proliferation, and apoptosis. It is involved in embryonic development, tissue repair and immune regulation. FGF-9 Protein, Human (HEK293, Fc, solution) is the recombinant human-derived FGF-9 protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

FGF-9 Protein, Human (HEK293, Fc, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-9-protein-human-hek293-fc.html

Purity

93.50

Smiles

LGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Molecular Formula

2254 (Gene_ID) NP_002001.1 (L4-S208) (Accession)

Molecular Weight

Approximately 54 kDa & 37 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PALB2, ID (PALB2, FANCN, Partner and localizer of BRCA2) (MaxLight 550)
MBS6330611-01 0.1 mL

PALB2, ID (PALB2, FANCN, Partner and localizer of BRCA2) (MaxLight 550)

Ask
View Details
PALB2, ID (PALB2, FANCN, Partner and localizer of BRCA2) (MaxLight 550)
MBS6330611-02 5x 0.1 mL

PALB2, ID (PALB2, FANCN, Partner and localizer of BRCA2) (MaxLight 550)

Ask
View Details
Gliomedin (GLDN) (NM_181789) Human Over-expression Lysate
LC405620 20 µg

Gliomedin (GLDN) (NM_181789) Human Over-expression Lysate

Ask
View Details
Glutamine synthetase Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61160R-BF594-01 20 µL

Glutamine synthetase Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Ask
View Details
Glutamine synthetase Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61160R-BF594-02 100 µL

Glutamine synthetase Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Ask
View Details
Guinea pig Nephrin ELISA Kit
MBS729383-01 48 Well

Guinea pig Nephrin ELISA Kit

Ask
View Details