Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-9, Human (HEK293, Fc, solution)

Activin AB protein is a member of the transforming growth factor-β (TGF-β) superfamily and plays a key role in various biological processes such as cell differentiation, proliferation, and apoptosis. It is involved in embryonic development, tissue repair and immune regulation. FGF-9 Protein, Human (HEK293, Fc, solution) is the recombinant human-derived FGF-9 protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

FGF-9 Protein, Human (HEK293, Fc, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-9-protein-human-hek293-fc.html

Purity

93.50

Smiles

LGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Molecular Formula

2254 (Gene_ID) NP_002001.1 (L4-S208) (Accession)

Molecular Weight

Approximately 54 kDa & 37 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD40 Ligand / CD154 / TRAP1 (Activation Marker of T-Lymphocytes) (CD40LG/2761), CF640R conjugate, 0.1mg/mL
BNC402761-500 1x 500 µL

CD40 Ligand / CD154 / TRAP1 (Activation Marker of T-Lymphocytes) (CD40LG/2761), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Axin 1 (AXIN1) (C-term) Rabbit Polyclonal Antibody
AP50319PU-N 400 µL

Axin 1 (AXIN1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZFAND2B Rabbit Polyclonal Antibody
TA371628 100 µL

ZFAND2B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Vertical Autoclave BAVT-3001
BAVT-3001 1 Unit

Vertical Autoclave BAVT-3001

Sign In for Pricing
View Details
HEC1 Recombinant Rabbit Monoclonal Antibody [JE31-10]
HA721395 100 µL

HEC1 Recombinant Rabbit Monoclonal Antibody [JE31-10]

Sign In for Pricing
View Details
EIF3S3 (EIF3H) Human Gene Knockout Kit (CRISPR)
KN401767 1 Kit

EIF3S3 (EIF3H) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details