Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCO1, Human (GST)

The SCO1 protein is a copper metal chaperone that contributes to the maturation of cytochrome c oxidase subunit II. SCO1 Protein, Human (GST) is the recombinant human-derived SCO1 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

SCO1 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sco1-protein-human-gst.html

Purity

95.0

Smiles

GKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYRKKS

Molecular Formula

6341 (Gene_ID) O75880 (G132-S301) (Accession)

Molecular Weight

Approximately 20.40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Salicylate
TRC-S634900-500G 500 g

Sodium Salicylate

Sign In for Pricing
View Details
MCFD2 Antibody
KC-26149-01 50 μL

MCFD2 Antibody

Sign In for Pricing
View Details
MCFD2 Antibody
KC-26149-02 100 µL

MCFD2 Antibody

Sign In for Pricing
View Details
MCFD2 Antibody
KC-26149-03 1 mL

MCFD2 Antibody

Sign In for Pricing
View Details
Xinjunan
TRC-X745130-100MG 100 mg

Xinjunan

Sign In for Pricing
View Details
IgG4 Recombinant Rabbit Monoclonal Antibody [ST05-12]
ET1609-56 100 µL

IgG4 Recombinant Rabbit Monoclonal Antibody [ST05-12]

Sign In for Pricing
View Details