Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCO1, Human (GST)

The SCO1 protein is a copper metal chaperone that contributes to the maturation of cytochrome c oxidase subunit II. SCO1 Protein, Human (GST) is the recombinant human-derived SCO1 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

SCO1 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sco1-protein-human-gst.html

Purity

95.0

Smiles

GKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYRKKS

Molecular Formula

6341 (Gene_ID) O75880 (G132-S301) (Accession)

Molecular Weight

Approximately 20.40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLURP1 Antibody
KC-8336-01 50 μL

SLURP1 Antibody

Sign In for Pricing
View Details
SLURP1 Antibody
KC-8336-02 100 µL

SLURP1 Antibody

Sign In for Pricing
View Details
SLURP1 Antibody
KC-8336-03 1 mL

SLURP1 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS704774 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Slc28a1 Mouse Gene Knockout Kit (CRISPR)
KN516018 1 Kit

Slc28a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MLH1 (MutL Homolog 1) (MLH1/1324), CF568 conjugate, 0.1mg/mL
BNC681324-100 1x 100 µL

MLH1 (MutL Homolog 1) (MLH1/1324), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details