Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-12, Rhesus Macaque (HEK293, His)

Interleukin-12 subunit alpha (IL-12A; IL-12p35), an immune-suppressive cytokine, encodes a subunit of the cytokine IL-12 that acts on T and natural killer cells, and has a broad array of biological activities. IL-12A heterodimerizes with IL-12B to form the IL-12 cytokine or with EBI3/IL27B to form the IL-35 cytokine[1][2]. IL-12 Protein, Rhesus Macaque (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag . It consists of IL-12A (M1-S219) and IL-12B (M1-S328) .

Product Specifications

Product Name Alternative

IL-12 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-12-protein-rhesus-macaque-hek293-his.html

Purity

96.00

Smiles

IL12A:RNLSVATPGPEMFPCLHHSQNLLKAASNTLQKARQILEFYPCTSEEIDHEDITKDKTSTVEACLPLELIKNESCLNSRETSFITNGSCLASRKTSFMMALCLRSIYEDLKMYQVEFKTMNAKLLRDPKRQIFLDQNILGVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASIL12B:IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSGEVLGSGKTLTIQVKEFGDAGQYTCHKGGEALSHSLLLLHKKEDGIWSTDVLKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSNPQGVTCGAVTLSAERVRGDNKEYEYSVECQEDSACPAAEERLPIEVMVDAIHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCIQVQGKSKREKKDRIFTDKTSATVICRKNASFSVQAQDRYYSSSWSEWASVPCS

Molecular Formula

703205&694747 (Gene_ID) P48091 (R23-S219) &P48095 (I23-S328) (Accession)

Molecular Weight

Approximately 60.2 kDa

References & Citations

[1]Ivy M Dambuza, et al. IL-12p35 induces expansion of IL-10 and IL-35-expressing regulatory B cells and ameliorates autoimmune disease. Nat Commun. 2017 Sep 28;8 (1) :719.|[2]Jin Kyeong Choi, et al. IL-12p35 Inhibits Neuroinflammation and Ameliorates Autoimmune Encephalomyelitis. Front Immunol. 2017 Oct 5;8:1258.|[3]D De Wit, et al. Helper T-cell responses elicited by Der p 1-pulsed dendritic cells and recombinant IL-12 in atopic and healthy subjects. J Allergy Clin Immunol. 2000 Feb;105 (2 Pt 1) :346-52.|[4]A A Ansari, et al. Administration of recombinant rhesus interleukin-12 during acute simian immunodeficiency virus (SIV) infection leads to decreased viral loads associated with prolonged survival in SIVmac251-infected rhesus macaques. J Virol. 2002 Feb;76 (4) :1731-43.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Arginase, Liver
7-02484 1 mg

Recombinant Human Arginase, Liver

Sign In for Pricing
View Details
2-Naphthalen-2-yl-ethylamine 99+% (HPLC)
230603-01 250 mg

2-Naphthalen-2-yl-ethylamine 99+% (HPLC)

Sign In for Pricing
View Details
2-Naphthalen-2-yl-ethylamine 99+% (HPLC)
230603-02 1 g

2-Naphthalen-2-yl-ethylamine 99+% (HPLC)

Sign In for Pricing
View Details
2-Naphthalen-2-yl-ethylamine 99+% (HPLC)
230603-03 5 g

2-Naphthalen-2-yl-ethylamine 99+% (HPLC)

Sign In for Pricing
View Details
PDLIM1 (NM_020992) Human Tagged ORF Clone
RC201674 10 µg

PDLIM1 (NM_020992) Human Tagged ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Rcc1l shRNA (UAS) - Lentiviral mouse Rcc1l shRNA (UAS, RFP) (100)
GTR15177204 1 Vial

Lentiviral mouse Rcc1l shRNA (UAS) - Lentiviral mouse Rcc1l shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details