Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-12, Rhesus Macaque (HEK293, His)

Interleukin-12 subunit alpha (IL-12A; IL-12p35), an immune-suppressive cytokine, encodes a subunit of the cytokine IL-12 that acts on T and natural killer cells, and has a broad array of biological activities. IL-12A heterodimerizes with IL-12B to form the IL-12 cytokine or with EBI3/IL27B to form the IL-35 cytokine[1][2]. IL-12 Protein, Rhesus Macaque (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag . It consists of IL-12A (M1-S219) and IL-12B (M1-S328) .

Product Specifications

Product Name Alternative

IL-12 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-12-protein-rhesus-macaque-hek293-his.html

Purity

96.00

Smiles

IL12A:RNLSVATPGPEMFPCLHHSQNLLKAASNTLQKARQILEFYPCTSEEIDHEDITKDKTSTVEACLPLELIKNESCLNSRETSFITNGSCLASRKTSFMMALCLRSIYEDLKMYQVEFKTMNAKLLRDPKRQIFLDQNILGVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASIL12B:IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSGEVLGSGKTLTIQVKEFGDAGQYTCHKGGEALSHSLLLLHKKEDGIWSTDVLKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSNPQGVTCGAVTLSAERVRGDNKEYEYSVECQEDSACPAAEERLPIEVMVDAIHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCIQVQGKSKREKKDRIFTDKTSATVICRKNASFSVQAQDRYYSSSWSEWASVPCS

Molecular Formula

703205&694747 (Gene_ID) P48091 (R23-S219) &P48095 (I23-S328) (Accession)

Molecular Weight

Approximately 60.2 kDa

References & Citations

[1]Ivy M Dambuza, et al. IL-12p35 induces expansion of IL-10 and IL-35-expressing regulatory B cells and ameliorates autoimmune disease. Nat Commun. 2017 Sep 28;8 (1) :719.|[2]Jin Kyeong Choi, et al. IL-12p35 Inhibits Neuroinflammation and Ameliorates Autoimmune Encephalomyelitis. Front Immunol. 2017 Oct 5;8:1258.|[3]D De Wit, et al. Helper T-cell responses elicited by Der p 1-pulsed dendritic cells and recombinant IL-12 in atopic and healthy subjects. J Allergy Clin Immunol. 2000 Feb;105 (2 Pt 1) :346-52.|[4]A A Ansari, et al. Administration of recombinant rhesus interleukin-12 during acute simian immunodeficiency virus (SIV) infection leads to decreased viral loads associated with prolonged survival in SIVmac251-infected rhesus macaques. J Virol. 2002 Feb;76 (4) :1731-43.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100A8 Rabbit pAb
E920474 100 µL

S100A8 Rabbit pAb

Sign In for Pricing
View Details
Nori® Monkey LIF ELISA Kit
GR169056 96 Well

Nori® Monkey LIF ELISA Kit

Sign In for Pricing
View Details
Zdhhc3 Mouse qPCR Primer Pair (NM_026917)
MP219070 200 Reactions

Zdhhc3 Mouse qPCR Primer Pair (NM_026917)

Sign In for Pricing
View Details
NAF1 Antibody
DF14357-01 100 µL

NAF1 Antibody

Sign In for Pricing
View Details
NAF1 Antibody
DF14357-02 200 µL

NAF1 Antibody

Sign In for Pricing
View Details
Monkey MLT ELISA Kit
EMKM0012 96 Tests

Monkey MLT ELISA Kit

Sign In for Pricing
View Details