Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neurturin, Human

Neurturin protein, vital in neurobiology, is key to supporting sympathetic neuron survival and implicated in regulating the central nervous system (CNS) . It influences neural growth, stability, and may modulate non-neuronal cell populations. Neurturin, a homodimer linked by disulfide bonds, maintains structural integrity for diverse cellular functions beyond neuronal survival. Neurturin Protein, Human is the recombinant human-derived Neurturin protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Neurturin Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/neurturin-protein-human.html

Purity

98.0

Smiles

ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV

Molecular Formula

4902 (Gene_ID) Q99748 (A96-V197) (Accession)

Molecular Weight

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse S100 Calcium Binding Protein A7 (S100A7) ELISA Kit
abx254397 96 Well

Mouse S100 Calcium Binding Protein A7 (S100A7) ELISA Kit

Sign In for Pricing
View Details
MIRacle™ hsa-miR-182-3p miRNA Agomir/Antagomir
AM0586 2 OD, 4 OD, 50 OD

MIRacle™ hsa-miR-182-3p miRNA Agomir/Antagomir

Sign In for Pricing
View Details
Human HOXC11 Recombinant Protein
PROTO43248-01 20 µg

Human HOXC11 Recombinant Protein

Sign In for Pricing
View Details
Human HOXC11 Recombinant Protein
PROTO43248-02 500 µg

Human HOXC11 Recombinant Protein

Sign In for Pricing
View Details
GENLISA™ Human Surfactant-associated Protein 2 (SFTA2) ELISA
KBH6236 1x 96 Well

GENLISA™ Human Surfactant-associated Protein 2 (SFTA2) ELISA

Sign In for Pricing
View Details
Olr799 (NM_001000854) Rat Tagged ORF Clone Lentiviral Particle
RR201156L4V 200 µL

Olr799 (NM_001000854) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details