CD3D, Human (HEK293, His)
CD3D protein is a component of the TCR-CD3 complex on T lymphocytes and plays a key role in adaptive immunity. It transmits signals through the CD3D, CD3E, CD3G, and CD3Z chains upon TCR engagement. CD3D Protein, Human (HEK293, His) is the recombinant human-derived CD3D protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
CD3D Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd3d-protein-human-hek-293-his.html
Purity
95.52
Smiles
FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA
Molecular Formula
915 (Gene_ID) P04234-1 (F22-A105) (Accession)
Molecular Weight
18-30 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
TRIM24 (Transcription Intermediary Factor 1-alpha, TIF1-alpha, E3 Ubiquitin-protein Ligase TRIM24, RING Finger Protein 82, Tripartite Motif-containing Protein 24, RNF82, TIF1, TIF1A) (MaxLight 405)
TRIM24 (Transcription Intermediary Factor 1-alpha, TIF1-alpha, E3 Ubiquitin-protein Ligase TRIM24, RING Finger Protein 82, Tripartite Motif-containing Protein 24, RNF82, TIF1, TIF1A) (MaxLight 405)
amfiSure ONE Taq DNA Polymerase, 1unit/ul, MgCl2 and dNTP Included
Poliovirus Receptor (PVR) Rabbit Monoclonal Antibody [Clone ID: R04-2C7]