Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Interleukin-10 (IL10)

Product Specifications

Product Name Alternative

Cytokine synthesis inhibitory factor (CSIF)

Abbreviation

Recombinant Rhesus macaque IL10 protein

Gene Name

IL10

UniProt

P51496

Expression Region

19-178aa

Organism

Macaca mulatta (Rhesus macaque)

Target Sequence

SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN

Tag

N-terminal DEEP1-tagged and C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Major immune regulatory cytokine that acts on many cells of the immune system where it has profound anti-inflammatory functions, limiting excessive tissue disruption caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric receptor comprising IL10RA and IL10RB leading to JAK1 and STAT2-mediated phosphorylation of STAT3.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.7 kDa

References & Citations

"Comparative sequence analysis of cytokine genes from human and nonhuman primates." Villinger F.J., Brar S.S., Mayne A.E., Chikkala N., Ansari A.A. J. Immunol. 155:3946-3954 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AZI1 Antibody - middle region (ARP73761_P050)
ARP73761_P050 100 µL

AZI1 Antibody - middle region (ARP73761_P050)

Sign In for Pricing
View Details
Avian Influenza Virus H9 Subtype (AIV-H9) ELISA Kit
NSL0013BI 96 Tests

Avian Influenza Virus H9 Subtype (AIV-H9) ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Apolipoprotein L2 (APOL2) ELISA kit
GTR10371914 96 Well

Guinea Pig Apolipoprotein L2 (APOL2) ELISA kit

Sign In for Pricing
View Details
Human Collagen Type XV (COL15) ELISA Kit
MBS451581-01 48 Tests

Human Collagen Type XV (COL15) ELISA Kit

Sign In for Pricing
View Details
Human Collagen Type XV (COL15) ELISA Kit
MBS451581-02 96 Tests

Human Collagen Type XV (COL15) ELISA Kit

Sign In for Pricing
View Details
Human Collagen Type XV (COL15) ELISA Kit
MBS451581-03 5x 96 Tests

Human Collagen Type XV (COL15) ELISA Kit

Sign In for Pricing
View Details