Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Interleukin-11 (IL11), Biotinylated

Product Specifications

Product Name Alternative

IL-11

Abbreviation

Recombinant Cynomolgus monkey Il11 protein, Biotinylated

Gene Name

Il11

UniProt

P20808

Expression Region

22-199aa

Organism

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Target Sequence

PGPPPGSPRASPDPRAELDSTVLLTRSLLEDTRQLTIQLKDKFPADGDHNLDSLPTLAMSAGALGALQLPSVLTRLRADLLSYLRHVQWLRRAMGSSLKTLEPELGTLQTRLDRLLRRLQLLMSRLALPQLPPDPPAPPLAPPSSTWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. Also promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and either IL11RA1 or IL11RA2 activates a signaling cascade that promotes cell proliferation. Signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

67.2 kDa

References & Citations

"Molecular cloning of a cDNA encoding interleukin 11, a stromal cell-derived lymphopoietic and hematopoietic cytokine." Paul S.R., Bennett F., Calvetti J.A., Kelleher K., Wood C.R., O'Hara R.M. Jr., Leary A.C., Sibley B.S., Clark S.C., Williams D.A., Yang Y.-C. Proc. Natl. Acad. Sci. U.S.A. 87:7512-7516 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF680R conjugate, 0.1mg/mL
BNC810152-100 1x 100 µL

CD11c (HC1/1), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL
BNC400977-100 1x 100 µL

TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF640R conjugate, 0.1mg/mL
BNC400342-500 1x 500 µL

CD43 (84-3C1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7/17 (C-46), CF640R conjugate, 0.1mg/mL
BNC400949-100 1x 100 µL

Cytokeratin 7/17 (C-46), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (115D8), CF740 conjugate, 0.1mg/mL
BNC740612-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (115D8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EMI1 (EMI1/1176), CF488A conjugate, 0.1mg/mL
BNC881176-500 1x 500 µL

EMI1 (EMI1/1176), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details