Activin RIA, Human (HEK293, His)
Activin A receptor, type I (ACVR1), also known as ALK-2, is a bone morphogenetic protein (BMP) type I receptor. ACVR1 is involved in a wide variety of biological processes, including bone, heart, cartilage, nervous, and reproductive system development and regulation[1]. Activin RIA Protein, Human (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 104 amino acids (M21-V124) .
Product Specifications
Product Name Alternative
Activin RIA Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/activin-ria-protein-human-hek293-his.html
Smiles
MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVHHHHHH
Molecular Formula
90 (Gene_ID) Q04771 (M21-V124) (Accession)
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Endothelial PAS Domain-Containing Protein 1 (EPAS1) Antibody
Endothelial PAS Domain-Containing Protein 1 (EPAS1) Antibody
Endothelial PAS Domain-Containing Protein 1 (EPAS1) Antibody
Podoplanin Protein, Mouse, Recombinant (His & hFc)