Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-23, Human (HEK293, C-His)

IL-23 and IL12B together constitute the pro-inflammatory cytokine IL-23, which is crucial in innate and adaptive immunity. IL-23 is released by antigen-presenting cells such as dendritic cells or macrophages, binds to IL12RB1 and IL23R, and activates JAK2 and TYK2. IL-23 Protein, Human (HEK293, His) is a recombinant protein dimer complex containing human-derived IL-23 alpha & IL-12 beta protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-23 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-23-protein-human-hek293-his.html

Purity

95.00

Smiles

IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS&RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

Molecular Formula

51561&3593 (Gene_ID) Q9NPF7 (R20-P189) &P29460 (I23-S328) (Accession)

Molecular Weight

Approximately 63-72 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5- (2,4-dioxo-1,3-diazinan-1-yl) -2-methylbenzoic acid
JH920589 1 Each

5- (2,4-dioxo-1,3-diazinan-1-yl) -2-methylbenzoic acid

Sign In for Pricing
View Details
Rat SHH Matched Antibody Pair Set [ABP-S-052409]
ABP-S-052409 5 Plates

Rat SHH Matched Antibody Pair Set [ABP-S-052409]

Sign In for Pricing
View Details
PRKRA (S246) Rabbit pAb
E2616420 100 µL

PRKRA (S246) Rabbit pAb

Sign In for Pricing
View Details
Rabbit Cytochrome P450 4V2 (CYP4V2) ELISA Kit
GTR10331474 96 Well

Rabbit Cytochrome P450 4V2 (CYP4V2) ELISA Kit

Sign In for Pricing
View Details
BLZF1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
13350064 1.0 µg DNA

BLZF1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
SPPL1 Antibody
orb842306 2 mg

SPPL1 Antibody

Sign In for Pricing
View Details