Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-1, Human (154a.a)

FGF-1 protein complexly regulates cell survival, division, angiogenesis, differentiation, and migration. As a potent mitogen, it acts as a ligand for FGFR1 and integrins. FGF-1 Protein, Human (154a.a) is the recombinant human-derived FGF-1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-1 Protein, Human (154a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-1-protein-human-154a-a.html

Purity

97.00

Smiles

AEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Molecular Formula

2246 (Gene_ID) P05230-1 (A2-D155) (Accession)

Molecular Weight

Approximately 17-18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Androsten-3beta,17beta-diol 17-Sulfate Sodium Salt
TRC-A102287-50MG 50 mg

4-Androsten-3beta,17beta-diol 17-Sulfate Sodium Salt

Sign In for Pricing
View Details
FCRLB Mouse Monoclonal Antibody [Clone ID: OTI5H5]
CF809246 100 µg

FCRLB Mouse Monoclonal Antibody [Clone ID: OTI5H5]

Sign In for Pricing
View Details
RBM3 (NM_006743) Human Recombinant Protein
TP760298 50 µg

RBM3 (NM_006743) Human Recombinant Protein

Sign In for Pricing
View Details
VIP Polyclonal Antibody
E-AB-64231-01 60 µL

VIP Polyclonal Antibody

Sign In for Pricing
View Details
VIP Polyclonal Antibody
E-AB-64231-02 120 µL

VIP Polyclonal Antibody

Sign In for Pricing
View Details
VIP Polyclonal Antibody
E-AB-64231-03 200 µL

VIP Polyclonal Antibody

Sign In for Pricing
View Details