Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell surface glycoprotein CD3 gamma chain (CD3G), partial

Product Specifications

Product Name Alternative

(T-cell receptor T3 gamma chain) (CD antigen CD3g)

Abbreviation

Recombinant Human CD3G protein, partial

Gene Name

CD3G

UniProt

P09693

Expression Region

23-116aa

Organism

Homo sapiens (Human)

Target Sequence

QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATIS

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition to this role of signal transduction in T-cell activation, CD3G plays an essential role in the dynamic regulation of TCR expression at the cell surface. Indeed, constitutive TCR cycling is dependent on the di-leucine-based (diL) receptor-sorting motif present in CD3G.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.2 kDa

References & Citations

"Differential biological role of CD3 chains revealed by human immunodeficiencies." Recio M.J., Moreno-Pelayo M.A., Kilic S.S., Guardo A.C., Sanal O., Allende L.M., Perez-Flores V., Mencia A., Modamio-Hoeybjoer S., Seoane E., Regueiro J.R. J. Immunol. 178:2556-2564 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat Trefoil Factor 2 (TFF2) CLIA Kit
abx196277 96 Tests

Rat Trefoil Factor 2 (TFF2) CLIA Kit

Ask
View Details
Anaphase Promoting Complex Subunit 5 (ANAPC5) Antibody
abx006897-01 20 µL

Anaphase Promoting Complex Subunit 5 (ANAPC5) Antibody

Ask
View Details
Anaphase Promoting Complex Subunit 5 (ANAPC5) Antibody
abx006897-02 100 µL

Anaphase Promoting Complex Subunit 5 (ANAPC5) Antibody

Ask
View Details
Anaphase Promoting Complex Subunit 5 (ANAPC5) Antibody
abx006897-03 2x 100 µL

Anaphase Promoting Complex Subunit 5 (ANAPC5) Antibody

Ask
View Details
Polyclonal Antibody to HGAL
11-7537-100 100 µg

Polyclonal Antibody to HGAL

Ask
View Details
Lentiviral human TNNT2 shRNA (UAS) - Lentiviral human TNNT2 shRNA (UAS, GFP) (100)
GTR15342000 1 Vial

Lentiviral human TNNT2 shRNA (UAS) - Lentiviral human TNNT2 shRNA (UAS, GFP) (100)

Ask
View Details