Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Mouse (HEK293, His)

The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT

Molecular Formula

245527 (Gene_ID) Q8BX35 (M1-T138) (Accession)

Molecular Weight

Approximately 26-29 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROCK1 (Rho-associated Protein Kinase 1, Renal Carcinoma Antigen NY-REN-35, Rho-associated, Coiled-coil-containing Protein Kinase 1, Rho-associated, Coiled-coil-containing Protein Kinase I, ROCK-I, p160 ROCK-1, p160ROCK, MGC131603, MGC43611) (PE)
132720-PE 100 µL

ROCK1 (Rho-associated Protein Kinase 1, Renal Carcinoma Antigen NY-REN-35, Rho-associated, Coiled-coil-containing Protein Kinase 1, Rho-associated, Coiled-coil-containing Protein Kinase I, ROCK-I, p160 ROCK-1, p160ROCK, MGC131603, MGC43611) (PE)

Sign In for Pricing
View Details
Human ZNF558 qPCR Primer Pair
QH64753S 200 Tests

Human ZNF558 qPCR Primer Pair

Sign In for Pricing
View Details
MARCH4 (MARCHF4) (NM_020814) Human Tagged Lenti ORF Clone
RC212197L3 10 µg

MARCH4 (MARCHF4) (NM_020814) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Biotinylated Anti-Mouse IgG antibody (1F9), Goat mAb
12-9567B-10 10 µg

Biotinylated Anti-Mouse IgG antibody (1F9), Goat mAb

Sign In for Pricing
View Details
MRLC2 (MYL12B, MYLC2B, Myosin Regulatory Light Chain 12B, MLC-2A, Myosin Regulatory Light Chain 2-B, Smooth Muscle Isoform, Myosin Regulatory Light Chain 20kD, Myosin Regulatory Light Chain MRLC2, SHUJUN-1) (HRP)
MBS6153587-01 0.1 mL

MRLC2 (MYL12B, MYLC2B, Myosin Regulatory Light Chain 12B, MLC-2A, Myosin Regulatory Light Chain 2-B, Smooth Muscle Isoform, Myosin Regulatory Light Chain 20kD, Myosin Regulatory Light Chain MRLC2, SHUJUN-1) (HRP)

Sign In for Pricing
View Details
MRLC2 (MYL12B, MYLC2B, Myosin Regulatory Light Chain 12B, MLC-2A, Myosin Regulatory Light Chain 2-B, Smooth Muscle Isoform, Myosin Regulatory Light Chain 20kD, Myosin Regulatory Light Chain MRLC2, SHUJUN-1) (HRP)
MBS6153587-02 5x 0.1 mL

MRLC2 (MYL12B, MYLC2B, Myosin Regulatory Light Chain 12B, MLC-2A, Myosin Regulatory Light Chain 2-B, Smooth Muscle Isoform, Myosin Regulatory Light Chain 20kD, Myosin Regulatory Light Chain MRLC2, SHUJUN-1) (HRP)

Sign In for Pricing
View Details