Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Mouse (HEK293, His)

The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT

Molecular Formula

245527 (Gene_ID) Q8BX35 (M1-T138) (Accession)

Molecular Weight

Approximately 26-29 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIWIL1 Rabbit Monoclonal Antibody [KD Validation]
E51K62591 40 µL

PIWIL1 Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
Lentiviral mouse Foxk2 shRNA (UAS) - Lentiviral mouse Foxk2 shRNA (UAS) (100)
GTR15124686 1 Vial

Lentiviral mouse Foxk2 shRNA (UAS) - Lentiviral mouse Foxk2 shRNA (UAS) (100)

Sign In for Pricing
View Details
Lentiviral mouse Utp18 shRNA (UAS) - Lentiviral mouse Utp18 shRNA (UAS, iRFP) plasmid
GTR15180004 1 Vial

Lentiviral mouse Utp18 shRNA (UAS) - Lentiviral mouse Utp18 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
RGD1310376 siRNA Oligos set (Rat)
39101176 3x 5 nmol

RGD1310376 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
QTRTD1 (QTRT2) (NM_024638) Human Over-expression Lysate
LH17529V 100 µg

QTRTD1 (QTRT2) (NM_024638) Human Over-expression Lysate

Sign In for Pricing
View Details
gadA Antibody, HRP conjugated
A50038-100UG 100 µg

gadA Antibody, HRP conjugated

Sign In for Pricing
View Details