Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Mouse (HEK293, His)

The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT

Molecular Formula

245527 (Gene_ID) Q8BX35 (M1-T138) (Accession)

Molecular Weight

Approximately 26-29 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complete Supplement Mixture w/o LEU-URA
G117-10G 1 unit

Complete Supplement Mixture w/o LEU-URA

Sign In for Pricing
View Details
Lentiviral human SRGAP1 shRNA (UAS) - Lentiviral human SRGAP1 shRNA (UAS, GFP) plasmid
GTR15307549 1 Vial

Lentiviral human SRGAP1 shRNA (UAS) - Lentiviral human SRGAP1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
XPO6 Protein Vector (Mouse) (pPB-C-His)
PV247870 500 ng

XPO6 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Human GDP-L-Fucose Synthase (TSTA3) AssayLite™ Antibody (FITC Conjugate)
31323-05141 2x 75 µg

Human GDP-L-Fucose Synthase (TSTA3) AssayLite™ Antibody (FITC Conjugate)

Sign In for Pricing
View Details
Canine AP2-Associated Protein Kinase 1 (AAK1) ELISA Kit
MBS9938357-01 48 Well

Canine AP2-Associated Protein Kinase 1 (AAK1) ELISA Kit

Sign In for Pricing
View Details
Canine AP2-Associated Protein Kinase 1 (AAK1) ELISA Kit
MBS9938357-02 96 Well

Canine AP2-Associated Protein Kinase 1 (AAK1) ELISA Kit

Sign In for Pricing
View Details