Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Mouse (HEK293, His)

The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT

Molecular Formula

245527 (Gene_ID) Q8BX35 (M1-T138) (Accession)

Molecular Weight

Approximately 26-29 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Gastric Inhibitory Polypeptide (GIP) ELISA Kit
NSL2044Hu 96 Tests

Human Gastric Inhibitory Polypeptide (GIP) ELISA Kit

Sign In for Pricing
View Details
ARHGEF15 CRISPR/Cas9 KO Plasmid (m)
sc-436735 20 µg

ARHGEF15 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
CENTG1 Peptide - middle region
MBS3235702-01 0.1 mg

CENTG1 Peptide - middle region

Sign In for Pricing
View Details
CENTG1 Peptide - middle region
MBS3235702-02 5x 0.1 mg

CENTG1 Peptide - middle region

Sign In for Pricing
View Details
CCCTC-Binding Factor (CTCF, CTCFL Paralog, 11-Zinc Finger Protein)
C2099-05G 100 µg

CCCTC-Binding Factor (CTCF, CTCFL Paralog, 11-Zinc Finger Protein)

Sign In for Pricing
View Details
PMVK Protein Vector (Human) (pPB-N-His)
PV031890 500 ng

PMVK Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details