Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Mouse (HEK293, His)

The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT

Molecular Formula

245527 (Gene_ID) Q8BX35 (M1-T138) (Accession)

Molecular Weight

Approximately 26-29 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Aeromonas Salmonicida asaI Protein
VAng-Lsx1196-50gEcoli 50 µg (E. coli)

Recombinant Aeromonas Salmonicida asaI Protein

Sign In for Pricing
View Details
BUB3 (MaxLight 550) (Drosophila) discontinued
302296-ML550 100 µL

BUB3 (MaxLight 550) (Drosophila) discontinued

Sign In for Pricing
View Details
RGD1359529 sgRNA CRISPR Lentivector set (Rat)
K6629701 3x 1.0 µg

RGD1359529 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Human PNPLA2 Protein Lysate
MBS8417463-01 0.02 mg

Human PNPLA2 Protein Lysate

Sign In for Pricing
View Details
Human PNPLA2 Protein Lysate
MBS8417463-02 5x 0.02 mg

Human PNPLA2 Protein Lysate

Sign In for Pricing
View Details
SAA1, Recombinant, Equine, aa1-110, His-Tag (Serum Amyloid A)
375187-01 20 µg

SAA1, Recombinant, Equine, aa1-110, His-Tag (Serum Amyloid A)

Sign In for Pricing
View Details