Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Mouse (HEK293, His)

The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT

Molecular Formula

245527 (Gene_ID) Q8BX35 (M1-T138) (Accession)

Molecular Weight

Approximately 26-29 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Pcbp3 Pre-designed siRNA Set A
SI210122A 1 Each

Rat Pcbp3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Yeast Genomic DNA Extraction kit
2522A 10 Tests

Yeast Genomic DNA Extraction kit

Sign In for Pricing
View Details
KCNH2 (Potassium Voltage-Gated Channel subfamily H Member 2, ERG1, HERG, LQT2, SQT1, HERG1, Kv11.1) discontinued
211614-01 20 µL

KCNH2 (Potassium Voltage-Gated Channel subfamily H Member 2, ERG1, HERG, LQT2, SQT1, HERG1, Kv11.1) discontinued

Sign In for Pricing
View Details
KCNH2 (Potassium Voltage-Gated Channel subfamily H Member 2, ERG1, HERG, LQT2, SQT1, HERG1, Kv11.1) discontinued
211614-02 100 µL

KCNH2 (Potassium Voltage-Gated Channel subfamily H Member 2, ERG1, HERG, LQT2, SQT1, HERG1, Kv11.1) discontinued

Sign In for Pricing
View Details
Anti-PAPPA-AS1 Antibody
CQA7671-01 30 µL

Anti-PAPPA-AS1 Antibody

Sign In for Pricing
View Details
Anti-PAPPA-AS1 Antibody
CQA7671-02 50 μL

Anti-PAPPA-AS1 Antibody

Sign In for Pricing
View Details