Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Mouse (HEK293, His)

The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT

Molecular Formula

245527 (Gene_ID) Q8BX35 (M1-T138) (Accession)

Molecular Weight

Approximately 26-29 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fatty Acid Binding Protein 5, Epidermal (FABP5) Antibody
abx122725-01 100 µg

Fatty Acid Binding Protein 5, Epidermal (FABP5) Antibody

Sign In for Pricing
View Details
Fatty Acid Binding Protein 5, Epidermal (FABP5) Antibody
abx122725-02 1 mg

Fatty Acid Binding Protein 5, Epidermal (FABP5) Antibody

Sign In for Pricing
View Details
Recombinant Human UHRF1 Protein, N-His
E55P4456 50 µg

Recombinant Human UHRF1 Protein, N-His

Sign In for Pricing
View Details
DES (Desmin) (MaxLight 490)
125781-ML490 100 µL

DES (Desmin) (MaxLight 490)

Sign In for Pricing
View Details
CYLD (NM_001042412) Human Mass Spec Standard
PH314451 10 µg

CYLD (NM_001042412) Human Mass Spec Standard

Sign In for Pricing
View Details
Mouse Monoclonal ILVBL Antibody (OTI8B12) [Alexa Fluor 700]
NBP2-71661AF700 0.1 mL

Mouse Monoclonal ILVBL Antibody (OTI8B12) [Alexa Fluor 700]

Sign In for Pricing
View Details