Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Mouse (HEK293, His)

The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT

Molecular Formula

245527 (Gene_ID) Q8BX35 (M1-T138) (Accession)

Molecular Weight

Approximately 26-29 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AIDA shRNA (h) Lentiviral Particles
sc-88746-V 200 µL

AIDA shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
UNC13D/Munc 13-4 Overexpression Lysate (Native) - (Dry Ice)
NBL1-17611 0.1 mg

UNC13D/Munc 13-4 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
FUBP1 (Far Upstream Element-binding Protein 1, DNA Helicase V, FBP, FUSE-binding Protein 1, hDH V) (PE)
127004-PE 100 µL

FUBP1 (Far Upstream Element-binding Protein 1, DNA Helicase V, FBP, FUSE-binding Protein 1, hDH V) (PE)

Sign In for Pricing
View Details
DLG2 Protein Vector (Mouse) (pPB-C-His)
PV172246 500 ng

DLG2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Adenovirus (Biotin)
MBS6242649-01 0.1 mL

Adenovirus (Biotin)

Sign In for Pricing
View Details
Adenovirus (Biotin)
MBS6242649-02 5x 0.1 mL

Adenovirus (Biotin)

Sign In for Pricing
View Details