Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Mouse (HEK293, His)

The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT

Molecular Formula

245527 (Gene_ID) Q8BX35 (M1-T138) (Accession)

Molecular Weight

Approximately 26-29 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GOSR1 (Golgi SNAP Receptor Complex Member 1, P28, GS28, GOS28, GOLIM2, GOS-28, GOS28/P28)
317691 100 µL

GOSR1 (Golgi SNAP Receptor Complex Member 1, P28, GS28, GOS28, GOLIM2, GOS-28, GOS28/P28)

Sign In for Pricing
View Details
Macrod2 Mouse Gene Knockout Kit (CRISPR)
KN509635 1 Kit

Macrod2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Integrin Alpha-L (ITGAL) Antibody
abx421822-01 50 µg

Integrin Alpha-L (ITGAL) Antibody

Sign In for Pricing
View Details
Integrin Alpha-L (ITGAL) Antibody
abx421822-02 100 µg

Integrin Alpha-L (ITGAL) Antibody

Sign In for Pricing
View Details
Rat Csf3r Pre-designed siRNA Set B
SI203314B 1 Each

Rat Csf3r Pre-designed siRNA Set B

Sign In for Pricing
View Details
COG7 Antibody (C-term) Blocking Peptide
MBS9223488-01 0.5 mg

COG7 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details