Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Mouse (HEK293, His)

The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT

Molecular Formula

245527 (Gene_ID) Q8BX35 (M1-T138) (Accession)

Molecular Weight

Approximately 26-29 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC692029 3'UTR GFP Stable Cell Line
TU262469 1.0 mL

LOC692029 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
SFXN1 sgRNA CRISPR Lentivector (Human) (Target 3)
K2135504 1.0 µg DNA

SFXN1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
TM6SF1 ORF Vector (Human) (pORF)
ORF010575 1.0 µg DNA

TM6SF1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
ZNF706 sgRNA CRISPR Lentivector (Human) (Target 3)
K2727504 1.0 µg DNA

ZNF706 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
UBQLN1 Antibody, Biotin conjugated
A71867-100UG 100 µg

UBQLN1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Porcine Beta-Defensin 115 (DEFB115) ELISA Kit
MBS9397591-01 48 Well

Porcine Beta-Defensin 115 (DEFB115) ELISA Kit

Sign In for Pricing
View Details