Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Mouse (HEK293, His)

The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT

Molecular Formula

245527 (Gene_ID) Q8BX35 (M1-T138) (Accession)

Molecular Weight

Approximately 26-29 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

8-Epidiosbulbin E acetate discontinued
371130 5 mg

8-Epidiosbulbin E acetate discontinued

Sign In for Pricing
View Details
RNASEL (RNS4) discontinued
513674 100 µg

RNASEL (RNS4) discontinued

Sign In for Pricing
View Details
MBD6 siRNA (Mouse)
CRN1152-01 15 nmol

MBD6 siRNA (Mouse)

Sign In for Pricing
View Details
MBD6 siRNA (Mouse)
CRN1152-02 30 nmol

MBD6 siRNA (Mouse)

Sign In for Pricing
View Details
Human TCF12 (NM_207038) AAV Particle
RC220246A1V 250 µL

Human TCF12 (NM_207038) AAV Particle

Sign In for Pricing
View Details
Ecel1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3813505 3x 1.0 µg

Ecel1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details