Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Mouse (HEK293, His)

The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT

Molecular Formula

245527 (Gene_ID) Q8BX35 (M1-T138) (Accession)

Molecular Weight

Approximately 26-29 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Aminochrysene
471110 250.0mg

6-Aminochrysene

Sign In for Pricing
View Details
Placental alkaline phosphatase (PLAP) Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-61630R-BF680-01 20 µL

Placental alkaline phosphatase (PLAP) Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Placental alkaline phosphatase (PLAP) Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-61630R-BF680-02 100 µL

Placental alkaline phosphatase (PLAP) Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
RTN4R, Control Peptide (Reticulon 4 Receptor, NOGOR, Reticulon-4 Receptor, Nogo Receptor, Nogo-66 Receptor)
148248 100 µg

RTN4R, Control Peptide (Reticulon 4 Receptor, NOGOR, Reticulon-4 Receptor, Nogo Receptor, Nogo-66 Receptor)

Sign In for Pricing
View Details
Glod5 Mouse shRNA Plasmid (Locus ID 69824)
TL516436 1 Kit

Glod5 Mouse shRNA Plasmid (Locus ID 69824)

Sign In for Pricing
View Details
Tollip (CT) (Toll interacting protein) (MaxLight 750) discontinued
T8063-52C-ML750 100 µL

Tollip (CT) (Toll interacting protein) (MaxLight 750) discontinued

Sign In for Pricing
View Details