Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Mouse (HEK293, His)

The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT

Molecular Formula

245527 (Gene_ID) Q8BX35 (M1-T138) (Accession)

Molecular Weight

Approximately 26-29 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRTAP10-9 3'UTR Luciferase Stable Cell Line
TU012163 1.0 mL

KRTAP10-9 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
EPS15R, NT (Epidermal Growth Factor Receptor Substrate 15-like 1, Eps15-related Protein, EPS15L1) (MaxLight 650)
MBS6474627-01 0.1 mL

EPS15R, NT (Epidermal Growth Factor Receptor Substrate 15-like 1, Eps15-related Protein, EPS15L1) (MaxLight 650)

Sign In for Pricing
View Details
EPS15R, NT (Epidermal Growth Factor Receptor Substrate 15-like 1, Eps15-related Protein, EPS15L1) (MaxLight 650)
MBS6474627-02 5x 0.1 mL

EPS15R, NT (Epidermal Growth Factor Receptor Substrate 15-like 1, Eps15-related Protein, EPS15L1) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Human CD217/IL17RA Protein, C-His (Active)
AHJ38905 100 μg

Recombinant Human CD217/IL17RA Protein, C-His (Active)

Sign In for Pricing
View Details
RAB41 (Ras-Related Protein Rab-41)
331732 100 µL

RAB41 (Ras-Related Protein Rab-41)

Sign In for Pricing
View Details
CASP14 Antibody
A46519-50UL 50 μL

CASP14 Antibody

Sign In for Pricing
View Details