Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Mouse (HEK293, His)

The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT

Molecular Formula

245527 (Gene_ID) Q8BX35 (M1-T138) (Accession)

Molecular Weight

Approximately 26-29 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TARS3 (NM_152334) Human Tagged ORF Clone
RG215029 10 µg

TARS3 (NM_152334) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human MIR8069-1 qPCR Primer Pair
QH87013S 200 Tests

Human MIR8069-1 qPCR Primer Pair

Sign In for Pricing
View Details
Npffr1 (NM_022291) Rat Untagged Clone
RN210301 10 µg

Npffr1 (NM_022291) Rat Untagged Clone

Sign In for Pricing
View Details
C14orf166 (RTRAF) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D6]
TA804056BM 100 µL

C14orf166 (RTRAF) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D6]

Sign In for Pricing
View Details
Anti-NR2E3 antibody
STJ192043 200 µl

Anti-NR2E3 antibody

Sign In for Pricing
View Details
Smarce1 (BC047141) Mouse Recombinant Protein
PM46586M5 20 µg

Smarce1 (BC047141) Mouse Recombinant Protein

Sign In for Pricing
View Details