Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Mouse (HEK293, His)

The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT

Molecular Formula

245527 (Gene_ID) Q8BX35 (M1-T138) (Accession)

Molecular Weight

Approximately 26-29 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DTWD1 qPCR Primer Pair
QH47169S 200 Tests

Human DTWD1 qPCR Primer Pair

Sign In for Pricing
View Details
Mouse Protein Tyrosine Phosphatase Receptor Type G (PTPRG) ELISA kit
YLA1037MO-01 48 Tests

Mouse Protein Tyrosine Phosphatase Receptor Type G (PTPRG) ELISA kit

Sign In for Pricing
View Details
Mouse Protein Tyrosine Phosphatase Receptor Type G (PTPRG) ELISA kit
YLA1037MO-02 96 Tests

Mouse Protein Tyrosine Phosphatase Receptor Type G (PTPRG) ELISA kit

Sign In for Pricing
View Details
LOC501233 (NM_001047967) Rat Tagged ORF Clone
RR211400 10 µg

LOC501233 (NM_001047967) Rat Tagged ORF Clone

Sign In for Pricing
View Details
SPATA8 Protein Vector (Human) (pPM-C-HA)
45235022 500 ng

SPATA8 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
RPS9P2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2020105 3x 1.0 µg

RPS9P2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details