Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Mouse (HEK293, His)

The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT

Molecular Formula

245527 (Gene_ID) Q8BX35 (M1-T138) (Accession)

Molecular Weight

Approximately 26-29 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tbc1d8 AAV siRNA Pooled Vector
46267166 1.0 µg

Tbc1d8 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
HES5 (Hairy and Enhancer of Split 5 (Drosophila), bHLHb38) (MaxLight 490)
247024-ML490 100 µL

HES5 (Hairy and Enhancer of Split 5 (Drosophila), bHLHb38) (MaxLight 490)

Sign In for Pricing
View Details
Recombinant Rat BRE Protein, His (Fc)-Avi-tagged
BRE-671R 50 µg

Recombinant Rat BRE Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Lentiviral mouse Ccdc36 shRNA (UAS) - Lentiviral mouse Ccdc36 shRNA (UAS, RFP) (25)
GTR15266063 1 Vial

Lentiviral mouse Ccdc36 shRNA (UAS) - Lentiviral mouse Ccdc36 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Rabbit Polyclonal FAM123A Antibody [CoraFluor 1]
NBP3-05964CL1 0.1 mL

Rabbit Polyclonal FAM123A Antibody [CoraFluor 1]

Sign In for Pricing
View Details
ID1, ID (ID1, BHLHB24, ID, DNA-binding protein inhibitor ID-1, Class B basic helix-loop-helix protein 24, Inhibitor of DNA binding 1) (Biotin) discontinued
036863-Biotin 200 µL

ID1, ID (ID1, BHLHB24, ID, DNA-binding protein inhibitor ID-1, Class B basic helix-loop-helix protein 24, Inhibitor of DNA binding 1) (Biotin) discontinued

Sign In for Pricing
View Details