Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Mouse (HEK293, His)

The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT

Molecular Formula

245527 (Gene_ID) Q8BX35 (M1-T138) (Accession)

Molecular Weight

Approximately 26-29 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSX7 HDR Plasmid (h)
sc-403553-HDR 20 µg

SSX7 HDR Plasmid (h)

Sign In for Pricing
View Details
RGNEF Adenovirus (Human)
39456051 1.0 mL

RGNEF Adenovirus (Human)

Sign In for Pricing
View Details
PHIP antibody
70R-19260 50 ul

PHIP antibody

Sign In for Pricing
View Details
Human Cadherin, Epithelial (CDHE) ELISA Kit
RDR-CDHE-Hu-01 96 Tests

Human Cadherin, Epithelial (CDHE) ELISA Kit

Sign In for Pricing
View Details
Human Cadherin, Epithelial (CDHE) ELISA Kit
RDR-CDHE-Hu-02 48 Tests

Human Cadherin, Epithelial (CDHE) ELISA Kit

Sign In for Pricing
View Details
RASL11B, NT (Ras-like Protein Family Member 11B)
MBS628174-01 0.2 mL

RASL11B, NT (Ras-like Protein Family Member 11B)

Sign In for Pricing
View Details