Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Mouse (HEK293, His)

The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT

Molecular Formula

245527 (Gene_ID) Q8BX35 (M1-T138) (Accession)

Molecular Weight

Approximately 26-29 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR52I1, CT (OR52I1, Olfactory receptor 52I1, Olfactory receptor OR11-13) (Azide free) (HRP) discontinued
039433-HRP 200 µL

OR52I1, CT (OR52I1, Olfactory receptor 52I1, Olfactory receptor OR11-13) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
CCDC158 Polyclonal Antibody, Cy7 Conjugated
bs-8122R-Cy7 100 µL

CCDC158 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal IRX1 Antibody (1A11)
H00079192-M04-100ug 100 µg

Mouse Monoclonal IRX1 Antibody (1A11)

Sign In for Pricing
View Details
Tissue, Membrane Protein, Human Adult Normal, Skeletal Muscle
MBS639871-01 0.1 mg

Tissue, Membrane Protein, Human Adult Normal, Skeletal Muscle

Sign In for Pricing
View Details
Tissue, Membrane Protein, Human Adult Normal, Skeletal Muscle
MBS639871-02 5x 0.1 mg

Tissue, Membrane Protein, Human Adult Normal, Skeletal Muscle

Sign In for Pricing
View Details
Mouse Monoclonal FCRN/FCGRT Antibody (937508) [Janelia Fluor 635]
FAB8639JF635 0.1 mL

Mouse Monoclonal FCRN/FCGRT Antibody (937508) [Janelia Fluor 635]

Sign In for Pricing
View Details