Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Mouse (HEK293, His)

The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT

Molecular Formula

245527 (Gene_ID) Q8BX35 (M1-T138) (Accession)

Molecular Weight

Approximately 26-29 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Anti-Mouse IgG2, Human/Bovine/Horse SP ads-UNLB
MBS675147-01 1 mg

Goat Anti-Mouse IgG2, Human/Bovine/Horse SP ads-UNLB

Sign In for Pricing
View Details
Goat Anti-Mouse IgG2, Human/Bovine/Horse SP ads-UNLB
MBS675147-02 5x 1 mg

Goat Anti-Mouse IgG2, Human/Bovine/Horse SP ads-UNLB

Sign In for Pricing
View Details
Biotinylated Anti-CD94 (dibotatug biosimilar) mAb
12-90120B-50 50 µg

Biotinylated Anti-CD94 (dibotatug biosimilar) mAb

Sign In for Pricing
View Details
Donkey Polyclonal Donkey anti-Human IgG (H+L) Secondary Antibody [PE]
NBP1-51847PE 1 mL

Donkey Polyclonal Donkey anti-Human IgG (H+L) Secondary Antibody [PE]

Sign In for Pricing
View Details
Rabbit Polyclonal UBLCP1 Antibody
NBP2-94630-0.02mL 0.02 mL

Rabbit Polyclonal UBLCP1 Antibody

Sign In for Pricing
View Details
LOC100361589 3'UTR GFP Stable Cell Line
TU258013 1.0 mL

LOC100361589 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details