Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDA2R/XEDAR, Mouse (HEK293, His)

The EDA2R/XEDAR protein is a receptor for EDA isoform A2 (but not A1) and plays a key role in activating the NF-kappa-B and JNK pathways. This activation involves binding to TRAF3 and TRAF6, as indicated by protein similarity. EDA2R/XEDAR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EDA2R/XEDAR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eda2r-xedar-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

MDCQENEYRDQWGRCVTCQQCGPGQELSKDCGYGEGGDAHCIVCPPRKYKSTWGHHRCQTCITCAVINRVQKANCTNTSNAICGDCLPRFYRKTRIGGLQDQECIPCTKQTPSSEVQCTFQLSLVKVDAHTVPPREAT

Molecular Formula

245527 (Gene_ID) Q8BX35 (M1-T138) (Accession)

Molecular Weight

Approximately 26-29 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMG20A cDNA Clone
MBS1267515-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

HMG20A cDNA Clone

Sign In for Pricing
View Details
HMG20A cDNA Clone
MBS1267515-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

HMG20A cDNA Clone

Sign In for Pricing
View Details
DUX4, ID (DUX4, DUX10, Double homeobox protein 4, Double homeobox protein 10, Double homeobox protein 4/10) (MaxLight 550) discontinued
034867-ML550 100 µL

DUX4, ID (DUX4, DUX10, Double homeobox protein 4, Double homeobox protein 10, Double homeobox protein 4/10) (MaxLight 550) discontinued

Sign In for Pricing
View Details
SH3BGR Protein Vector (Human) (pPM-C-HA)
43662021 500 ng

SH3BGR Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Papolb sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6345905 3x 1.0 µg

Papolb sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
ABCC2 Antibody
MBS9401541-01 0.05 mL

ABCC2 Antibody

Sign In for Pricing
View Details